KEGG   Pteropus alecto (black flying fox): 102884459
Entry
102884459         CDS       T02993                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04110  Cell cycle
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102884459 (E2F2)
   04218 Cellular senescence
    102884459 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884459 (E2F2)
   05206 MicroRNAs in cancer
    102884459 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102884459 (E2F2)
   05225 Hepatocellular carcinoma
    102884459 (E2F2)
   05226 Gastric cancer
    102884459 (E2F2)
   05214 Glioma
    102884459 (E2F2)
   05220 Chronic myeloid leukemia
    102884459 (E2F2)
   05218 Melanoma
    102884459 (E2F2)
   05219 Bladder cancer
    102884459 (E2F2)
   05215 Prostate cancer
    102884459 (E2F2)
   05224 Breast cancer
    102884459 (E2F2)
   05222 Small cell lung cancer
    102884459 (E2F2)
   05223 Non-small cell lung cancer
    102884459 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102884459 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884459 (E2F2)
   05161 Hepatitis B
    102884459 (E2F2)
   05160 Hepatitis C
    102884459 (E2F2)
   05163 Human cytomegalovirus infection
    102884459 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102884459 (E2F2)
   05169 Epstein-Barr virus infection
    102884459 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102884459 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102884459 (E2F2)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102884459 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102884459
NCBI-ProteinID: XP_006924510
LinkDB
Position
Unknown
AA seq 436 aa
MLRGPRALAPAAGPPLKGLPAMSPTELWPPGLGSPQLYPVTTTYYTPLYPQIVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVLEFRTPKGKCIRVDGLPSPQT
PKSPGEKTRYDTSLGLLTKKFIYLLRESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVSRGMFEDPTRPGKQQQLGQELKELMSMEQALDELIQSCSLNFTQLTE
DKANKRLAYVTYQDIRAVSNFKEQTVIAVKAPPQTRLEVPDGSEENLQLHLKSTQGPIEV
YLCQEEVQEPDSPAKEHLPSTSTLSPSPDFTQPSSSTNPGILEATASPAPALTSHQILSP
PPSLVPLEATDSMLELPYPLLQQTEDQFLSPTLPSSSPLISFSPPLDQDDYLWGLEGGEG
ISDLFDSYDLGDLLIN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcttcgagggccccgggccctggctccggccgctggaccacccctgaaggggctacct
gcgatgagccccaccgagctgtggcctcccggcctcggcagcccccagctctacccggtc
accactacctactacaccccgctgtacccacagattgtgcctcccgctgcagcgcccggc
acctgcctggacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
gggcggctgccggccaaaaggaagctggacctggaggggatcgggaggcctgcggttctg
gaatttcggactcccaaggggaagtgcattagagtggatggcctccccagcccccaaacc
cccaagtcccccggggagaagactcggtatgatacgtcgctggggctgctcaccaagaag
ttcatttacctcctgagagagtccaaggatggggtcctggacctgaactgggctgccgag
gtgctagatgtgcagaagcggcgcatctatgacatcaccaatgtgctagagggcatccag
ctcatccggaagaaggccaagaacaacatccagtgggtaagcaggggaatgtttgaagac
cccacccggcctgggaagcagcagcagctggggcaggagctgaaggagctgatgagcatg
gagcaggccttggacgagctcatccagagctgctctctgaacttcacacaactgaccgag
gacaaggccaacaagagactggcctatgtgacttaccaggacatccgtgctgtcagcaac
tttaaggagcagacagtgatcgctgtcaaggcccctccacagacaagactggaagtgccc
gacgggagcgaggagaacctgcagttacatctgaagagcacgcaagggcccattgaagtc
tacctgtgccaggaggaggtgcaggaaccagacagtcctgccaaggaacacctcccctcc
acctccaccctcagccctagccctgacttcactcagcccagcagcagcaccaaccctggg
atcctggaagccacagcatccccagcaccagcgctgacttcccaccagatcctgtcgccg
ccaccatcccttgttcctctagaggccactgacagcatgctggagctgccatacccactt
ctgcagcagaccgaggaccagttcctgtccccaacactgccaagcagctcccctctgatc
agcttctctccacccttggatcaagatgactacctgtggggcctggaagggggcgagggc
atcagtgacctctttgactcctatgacctcggggatctgctgattaattga

KEGG   Pteropus alecto (black flying fox): 102887239
Entry
102887239         CDS       T02993                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04110  Cell cycle
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102887239 (E2F3)
   04218 Cellular senescence
    102887239 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887239 (E2F3)
   05206 MicroRNAs in cancer
    102887239 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102887239 (E2F3)
   05225 Hepatocellular carcinoma
    102887239 (E2F3)
   05226 Gastric cancer
    102887239 (E2F3)
   05214 Glioma
    102887239 (E2F3)
   05220 Chronic myeloid leukemia
    102887239 (E2F3)
   05218 Melanoma
    102887239 (E2F3)
   05219 Bladder cancer
    102887239 (E2F3)
   05215 Prostate cancer
    102887239 (E2F3)
   05224 Breast cancer
    102887239 (E2F3)
   05222 Small cell lung cancer
    102887239 (E2F3)
   05223 Non-small cell lung cancer
    102887239 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102887239 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102887239 (E2F3)
   05161 Hepatitis B
    102887239 (E2F3)
   05160 Hepatitis C
    102887239 (E2F3)
   05163 Human cytomegalovirus infection
    102887239 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102887239 (E2F3)
   05169 Epstein-Barr virus infection
    102887239 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102887239 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102887239 (E2F3)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102887239 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102887239
NCBI-ProteinID: XP_024900673
LinkDB
Position
Unknown
AA seq 358 aa
MGPSENPAALSCLNAVFASGETISLVTYDQAKRRLELGESGHQYLSDGLKTPKGKGRAAL
RNPDSPKKKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEG
IHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLL
TEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPVESLQIHLASTQGPIE
VYLCPEETETHSPMKTNNQDHNGNIPKPTSKDLASTISGHSDCSISMANLSPLASPANLL
QQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggtccatcagagaatcctgctgccctcagctgtcttaacgctgtttttgcctctgga
gaaacaatcagccttgtcacctatgatcaggccaagcgaaggctggagctaggagaaagc
ggtcaccagtacctctcagatggtttaaaaaccccaaagggcaaagggagagctgcactg
cgaaatccagacagtcccaaaaaaaaaacacggtatgatacatcacttggtctactcacc
aagaagttcattcagctactgagccaatcacctgatggggtcttggatttgaacaaggca
gcagaggtgctgaaagtgcaaaagagaaggatttatgatatcaccaatgtgctggaaggc
atccacctcattaagaagaagtctaaaaacaacgtgcaatggatgggctgcagtctgtct
gaggatgggggcatgctggcccagtgtcaaggcctgtcaaaggaagtgaccgagctcagt
caggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaactgtta
accgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcgaaaaatt
agtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaagacttgaa
gtgcctgacccagtagagagcctacaaatacacttggcaagtacccaaggacccattgag
gtttacttgtgtccagaagagactgaaacacatagtccaatgaaaacaaacaaccaagac
cacaatgggaatatccctaaacccacttccaaagacttggcttcaaccatctcaggacat
agcgattgctcgatttctatggcaaacctttctcctttggcctccccagccaacctttta
cagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaacttactgcct
cccctgctccaagaagactatctcctaagccttggggaggaagaaggcatcagtgatctc
tttgatgcttatgatttggaaaaactcccgctggtggaagactttatgtgtagttga

KEGG   Pteropus alecto (black flying fox): 102895276
Entry
102895276         CDS       T02993                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04110  Cell cycle
pale04137  Mitophagy - animal
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102895276 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102895276 (E2F1)
   04218 Cellular senescence
    102895276 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895276 (E2F1)
   05206 MicroRNAs in cancer
    102895276 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102895276 (E2F1)
   05225 Hepatocellular carcinoma
    102895276 (E2F1)
   05226 Gastric cancer
    102895276 (E2F1)
   05214 Glioma
    102895276 (E2F1)
   05220 Chronic myeloid leukemia
    102895276 (E2F1)
   05218 Melanoma
    102895276 (E2F1)
   05219 Bladder cancer
    102895276 (E2F1)
   05215 Prostate cancer
    102895276 (E2F1)
   05224 Breast cancer
    102895276 (E2F1)
   05222 Small cell lung cancer
    102895276 (E2F1)
   05223 Non-small cell lung cancer
    102895276 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102895276 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895276 (E2F1)
   05161 Hepatitis B
    102895276 (E2F1)
   05160 Hepatitis C
    102895276 (E2F1)
   05163 Human cytomegalovirus infection
    102895276 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895276 (E2F1)
   05169 Epstein-Barr virus infection
    102895276 (E2F1)
   05165 Human papillomavirus infection
    102895276 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102895276 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102895276 (E2F1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102895276 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102895276
NCBI-ProteinID: XP_015452376
LinkDB
Position
Unknown
AA seq 558 aa
MGNGDGTQALQFPEQHRGSHQTGCTTFTKEDKQVSSRFPVEVIWGALPSPLRDCISYVPI
NPGTKCRSAGVSKKMKKRKAARSKANLECTGDAEDHENNLKAYDIAGTIPGTFCYTDEGS
CLHPPDLEAHAITFTSSCLLENQGKDISNPKIMGSGASTSLDSSKKLVEVVLGAAPASGP
CDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKG
VKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQ
LIAKKSKNHIQWLGSHAAVGIGGRLEGLTQDLQQLQEDERHLDHLIHICTTQLRLLSEDT
DSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLC
PEESAGGASPGKTPSQGAASGEEDRAADFATTVPPPSSPPSSPATDPSQSLLSLEQEPLL
SRMGSLRAPVDEDRLSPLVAADSLLEQVREDFSGLLPEEFISLSPPHGALDYHFGLEEGE
GIRDLFDCDFGDLTPLDF
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgggaaatggggatggcacccaggccttgcagttccctgagcaacatcgaggttcccat
cagacaggctgcaccaccttcactaaggaggacaagcaagtgagctcacggtttccagtg
gaagtgatctggggagccctcccttctcccctccgtgactgcattagctatgtgcctatc
aacccagggaccaaatgcaggtcagcaggtgtcagcaagaaaatgaaaaaaagaaaagct
gctcgttccaaggccaacctcgaatgtactggtgatgctgaagatcatgagaataatctg
aaagcttatgacatagccggcaccatacctggcactttctgttacacagatgaaggttcc
tgcttacatccacctgatttagaagcacatgctatcacttttacatcatcctgcctcttg
gaaaatcaagggaaagatatctccaacccaaagatcatgggctcaggagcttctacttct
ttggactcaagtaagaagttggtggaggtggtgctgggggcagcgcctgcctcgggcccc
tgcgaccccgacttgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcg
ccgcgcccggcgctcggccgcccgccggtgaagagaagactggacctggaaactgaccat
caatacctggctgagagcagtgggccagctcggggcagaggccgccacccaggaaaaggt
gtaaaatccccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgc
ttcctggagctgctgagccgctcagctgatggcgttgttgacctgaactgggcagctgag
gtactgaaggtgcagaaacggcgcatctacgacatcaccaatgtcctcgagggcatccag
ctcatcgccaagaagtccaagaatcacatccagtggctaggcagccatgcagcagtgggg
attggtgggcggcttgaaggactgacccaggatctccagcaactgcaggaggacgaacga
cacctggaccacctgatccacatctgtaccacgcaactgcggctgctctctgaggacacc
gacagccagcgcctggcctacgtgacctgccaggaccttcgtagcattgcagaccctgca
gagcagatggtcatggtgatcaaggcccctcctgagacccagcttcaagccgtggactcc
tcagagacctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgc
cctgaggagagtgcgggcggggccagccctgggaagaccccatcccagggggcagcttct
ggggaggaggacagggcagctgactttgccaccacagtgccaccaccatcatctccccca
tcatcccctgccacggatcccagccagtccctgctcagcctggagcaagaacctctgctt
tcccggatgggtagcctgcgggcccctgtggatgaggaccgcctttccccgctggtggca
gccgactcactgctggagcaagtgcgggaggacttctctggccttctccctgaggagttc
atcagcctatctcccccccatggggcccttgactaccactttggccttgaggagggcgag
ggcatcagagacctctttgactgtgactttggggacctcacccctctggatttctga

DBGET integrated database retrieval system