KEGG   Pteropus alecto (black flying fox): 102884470
Entry
102884470         CDS       T02993                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale05144  Malaria
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05211  Renal cell carcinoma
pale05218  Melanoma
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102884470 (HGF)
   04014 Ras signaling pathway
    102884470 (HGF)
   04015 Rap1 signaling pathway
    102884470 (HGF)
   04020 Calcium signaling pathway
    102884470 (HGF)
   04151 PI3K-Akt signaling pathway
    102884470 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102884470 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884470 (HGF)
   05205 Proteoglycans in cancer
    102884470 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102884470 (HGF)
   05226 Gastric cancer
    102884470 (HGF)
   05218 Melanoma
    102884470 (HGF)
   05211 Renal cell carcinoma
    102884470 (HGF)
   05223 Non-small cell lung cancer
    102884470 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    102884470 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102884470 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102884470 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102884470 (HGF)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102884470 (HGF)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102884470 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF316 DUF1986
Other DBs
NCBI-GeneID: 102884470
NCBI-ProteinID: XP_006925800
LinkDB
Position
Unknown
AA seq 725 aa
MWVTKLLPVLLLQQVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLHKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSYRGKDLQENYCRNPRGEEG
GPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDQQMPHRHKF
LPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSSMNDSNVPMETTEC
IQAQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAESPWC
FTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRH
IFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI
SCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNKDLKD
YEAWLGIHDVHGRGDEKRRQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPNYG
CTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAGAEN
IVTGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTY
KVPQS
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagtcctgctgctgcagcaggtcctcctacatctcctg
ctgcttcccatcgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaatttaaaaagtcagcaaagactactctacataaagaagacccgttactgaagataaaa
acaaaaaaaatgaacacagcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaagaaaacgatgcctctggttccct
ttcaatagcatgtcaagtggggtgaaaaaagaatttggccatgaattcgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggta
tctatcactaagagtggcatcaaatgccagccctggaattccatgatcccacatgaacac
agctatcggggtaaagacctacaggaaaactactgtcgaaatcctcgaggggaagaaggg
ggaccttggtgtttcacaagcaatccagaggtacgctacgaagtctgtgacattcctcag
tgttcagaagttgaatgcatgacgtgcaatggggaaagttatcgaggtcccatggatcat
acagaatcaggcaagatttgtcagcgctgggatcagcagatgccacatcggcacaaattc
ttgccagaaagatatcccgacaagggctttgatgataattattgccgcaatcctgatggc
aagccgaggccatggtgctatactcttgaccctgacaccccgtgggagtactgtgcaatt
aaaatgtgtgctcacagttctatgaatgactcaaatgtccctatggaaacaactgaatgc
atacaagctcaaggagaaggttatcgaggcaccatcaataccatttggaatggaattcca
tgtcagcgatgggattcccaataccctcaccaacatgacataacacctgaaaatttcaag
tgcaaggacctaagagaaaattattgccggaatccagatggggctgagtcaccctggtgt
tttaccactgatccaaacatccgagttggctactgctcccaaattccaaaatgtgacgtg
tcaagtggacaagactgctatcgtggaaatggcaaaaattatatgggcaatttatccaaa
acacgatctggactaacatgttcaatgtgggacaagaacatggaagacttacaccggcac
atcttctgggaaccagatgctagtaagttgaataagaattactgccggaatcctgacgat
gatgcccatggtccttggtgttacacagggaaccctctcattccttgggattactgcccc
atttctcgttgtgaaggtgataccacacctacaatagtcaatttagaccatcctgtaata
tcttgcgccaaaacaaaacaattgcgagttgtaaatggaattccaacacgaacaaatgta
ggatggatggttagtttgaaatacagaaataaacatatctgcggaggatcattgataaaa
gaaagttggattcttactgcaagacagtgtttcccttctcgaaacaaagacttgaaagat
tatgaagcttggcttggaatccatgatgtccatggaagaggagatgagaaacgcagacag
gttctaaatgtttctcagctggtgtatgggcctgaaggatcagatctggtattactgaag
cttgctagacctgctgtcctggatgattttgttagtacaatcgatttacctaattatggg
tgcacaattcctgaaaaaaccacttgcagtgtttatggctggggctacactggattgatc
aactctgacggtctattacgagtagcacatctctatattatggggaatgagaaatgcagc
caatatcatcaagggaaggtgactctgaatgagtctgaaatatgtgctggagctgaaaat
attgtaacaggaccatgcgagggagactatggtggcccacttgtttgtgaacagcataaa
atgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattccaaaccgtcct
ggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatattaacatat
aaggtaccacagtcatag

DBGET integrated database retrieval system