KEGG   Pteropus alecto (black flying fox): 102884991
Entry
102884991         CDS       T02993                                 

Gene name
SOST
Definition
(RefSeq) sclerostin
  KO
K16834  sclerostin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04310  Wnt signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102884991 (SOST)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    102884991 (SOST)
SSDB
Motif
Pfam: Sclerostin DAN Cys_knot
Other DBs
NCBI-GeneID: 102884991
NCBI-ProteinID: XP_006910152
UniProt: L5KSD8
LinkDB
Position
Unknown
AA seq 213 aa
MQLSLALCLVCLLVHAAFCAVEAQGWQAFKNDATEIIPEMDEYPEPPPELENNKTMNRAE
NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG
RGKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRARKVRLVASCKCKRLTRFHNQSELK
DFGPEAVRPQKGRKPRPRARGVKANQAELENAY
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcagctctctcttgccctgtgtctcgtctgcctgctggtgcacgcagccttctgtgcg
gtggaggcccaggggtggcaggccttcaagaacgatgccaccgaaatcatccctgagatg
gacgagtaccccgagcccccaccagagctggagaacaacaagaccatgaaccgggcggag
aacggagggaggcctccgcaccacccctttgagactaaagacgtgtccgagtacagctgc
cgcgagctgcacttcacccgctacgtgacggacgggccgtgccgcagtgccaagccggtc
actgagctcgtgtgctcgggccagtgtggacccgcacgcctgctgcccaacgccatcggc
cgcggcaagtggtggcgcccgaacgggcccgacttccgctgcatccccgaccgctaccgc
gcgcagcgggtgcagctgctgtgtcctggcggcgcagcgccgcgcgcgcgcaaggtgcgc
ctggtggcctcttgcaagtgcaagcgcctcacccggttccacaaccagtcggagctcaag
gactttgggccagaggccgtgcggccgcagaagggtcggaagccgcggccccgcgctcgg
ggcgttaaagccaaccaggccgagctggagaatgcctactag

DBGET integrated database retrieval system