KEGG   Pteropus alecto (black flying fox): 102885064
Entry
102885064         CDS       T02993                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X5
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04024  cAMP signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04137  Mitophagy - animal
pale04140  Autophagy - animal
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04530  Tight junction
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04728  Dopaminergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04917  Prolactin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04926  Relaxin signaling pathway
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05231  Choline metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102885064 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885064 (MAPK10)
   04012 ErbB signaling pathway
    102885064 (MAPK10)
   04014 Ras signaling pathway
    102885064 (MAPK10)
   04310 Wnt signaling pathway
    102885064 (MAPK10)
   04668 TNF signaling pathway
    102885064 (MAPK10)
   04068 FoxO signaling pathway
    102885064 (MAPK10)
   04071 Sphingolipid signaling pathway
    102885064 (MAPK10)
   04024 cAMP signaling pathway
    102885064 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102885064 (MAPK10)
   04137 Mitophagy - animal
    102885064 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102885064 (MAPK10)
   04215 Apoptosis - multiple species
    102885064 (MAPK10)
   04217 Necroptosis
    102885064 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885064 (MAPK10)
   04530 Tight junction
    102885064 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102885064 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102885064 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102885064 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102885064 (MAPK10)
   04660 T cell receptor signaling pathway
    102885064 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102885064 (MAPK10)
   04659 Th17 cell differentiation
    102885064 (MAPK10)
   04657 IL-17 signaling pathway
    102885064 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102885064 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102885064 (MAPK10)
   04920 Adipocytokine signaling pathway
    102885064 (MAPK10)
   04912 GnRH signaling pathway
    102885064 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102885064 (MAPK10)
   04917 Prolactin signaling pathway
    102885064 (MAPK10)
   04926 Relaxin signaling pathway
    102885064 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102885064 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102885064 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102885064 (MAPK10)
   04722 Neurotrophin signaling pathway
    102885064 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102885064 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102885064 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885064 (MAPK10)
   05231 Choline metabolism in cancer
    102885064 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885064 (MAPK10)
   05212 Pancreatic cancer
    102885064 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885064 (MAPK10)
   05012 Parkinson disease
    102885064 (MAPK10)
   05016 Huntington disease
    102885064 (MAPK10)
   05017 Spinocerebellar ataxia
    102885064 (MAPK10)
   05020 Prion disease
    102885064 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102885064 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102885064 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102885064 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102885064 (MAPK10)
   04931 Insulin resistance
    102885064 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885064 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102885064 (MAPK10)
   05135 Yersinia infection
    102885064 (MAPK10)
   05133 Pertussis
    102885064 (MAPK10)
   05152 Tuberculosis
    102885064 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885064 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102885064 (MAPK10)
   05161 Hepatitis B
    102885064 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102885064 (MAPK10)
   05162 Measles
    102885064 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885064 (MAPK10)
   05169 Epstein-Barr virus infection
    102885064 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102885064 (MAPK10)
   05142 Chagas disease
    102885064 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102885064 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885064 (MAPK10)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102885064 (MAPK10)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102885064 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102885064
NCBI-ProteinID: XP_006907635
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagt
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggaactagtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtctttacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccatgagcgaatgtcttacctcctataccaaatgttgtgtggcatcaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgacttcggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagagcccccgaggtcatcttgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccaatggaacaaggtaattgagcaactagga
acaccgtgtccggaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgccggactcaccttccccaagctctttccagattccctcttcccagcg
gattccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtcattgacccagccaaaaggatatcagtggatgacgctttacagcacccatatatcaat
gtctggtatgaccctgccgaagtggaggcgcctccacctcagatatatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcggaagaaaagactaaaaatggtgtcgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccttcctcgtccgtcaatgacatctcctccatgtcc
actgaccagaccctggcatctgacactgacagcagcctggaagcctcggcgggacccctg
ggttgttgcaggtga

KEGG   Pteropus alecto (black flying fox): 102890689
Entry
102890689         CDS       T02993                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04024  cAMP signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04137  Mitophagy - animal
pale04140  Autophagy - animal
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04530  Tight junction
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04728  Dopaminergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04917  Prolactin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04926  Relaxin signaling pathway
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05231  Choline metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102890689 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102890689 (MAPK9)
   04012 ErbB signaling pathway
    102890689 (MAPK9)
   04014 Ras signaling pathway
    102890689 (MAPK9)
   04310 Wnt signaling pathway
    102890689 (MAPK9)
   04668 TNF signaling pathway
    102890689 (MAPK9)
   04068 FoxO signaling pathway
    102890689 (MAPK9)
   04071 Sphingolipid signaling pathway
    102890689 (MAPK9)
   04024 cAMP signaling pathway
    102890689 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102890689 (MAPK9)
   04137 Mitophagy - animal
    102890689 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102890689 (MAPK9)
   04215 Apoptosis - multiple species
    102890689 (MAPK9)
   04217 Necroptosis
    102890689 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102890689 (MAPK9)
   04530 Tight junction
    102890689 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102890689 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102890689 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102890689 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102890689 (MAPK9)
   04660 T cell receptor signaling pathway
    102890689 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    102890689 (MAPK9)
   04659 Th17 cell differentiation
    102890689 (MAPK9)
   04657 IL-17 signaling pathway
    102890689 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    102890689 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102890689 (MAPK9)
   04920 Adipocytokine signaling pathway
    102890689 (MAPK9)
   04912 GnRH signaling pathway
    102890689 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102890689 (MAPK9)
   04917 Prolactin signaling pathway
    102890689 (MAPK9)
   04926 Relaxin signaling pathway
    102890689 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    102890689 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    102890689 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    102890689 (MAPK9)
   04722 Neurotrophin signaling pathway
    102890689 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102890689 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102890689 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890689 (MAPK9)
   05231 Choline metabolism in cancer
    102890689 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102890689 (MAPK9)
   05212 Pancreatic cancer
    102890689 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102890689 (MAPK9)
   05012 Parkinson disease
    102890689 (MAPK9)
   05016 Huntington disease
    102890689 (MAPK9)
   05017 Spinocerebellar ataxia
    102890689 (MAPK9)
   05020 Prion disease
    102890689 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    102890689 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102890689 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102890689 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    102890689 (MAPK9)
   04931 Insulin resistance
    102890689 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102890689 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102890689 (MAPK9)
   05135 Yersinia infection
    102890689 (MAPK9)
   05133 Pertussis
    102890689 (MAPK9)
   05152 Tuberculosis
    102890689 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102890689 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    102890689 (MAPK9)
   05161 Hepatitis B
    102890689 (MAPK9)
   05171 Coronavirus disease - COVID-19
    102890689 (MAPK9)
   05162 Measles
    102890689 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102890689 (MAPK9)
   05169 Epstein-Barr virus infection
    102890689 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102890689 (MAPK9)
   05142 Chagas disease
    102890689 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102890689 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102890689 (MAPK9)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102890689 (MAPK9)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102890689 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102890689
NCBI-ProteinID: XP_006923304
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSHATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctaaaacgttaccagcagttgaaaccgattgggtctggagcccaaggaattgtt
tgtgctgctttcgataccgttcttgggataaatgttgcagtcaagaaactaagtcggcct
tttcagaatcaaactcatgcaaagagagcctatcgcgaactcgtcctcctaaaatgtgtc
aatcataaaaatatcattagtttgttaaatgtgtttacgccacaaaaaactctagaagaa
tttcaagatgtgtacttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctatcttctttaccagatgctctgtggtattaaa
catttgcattcagctggtatcatccatagagatttgaaacctagcaacattgtagtgaag
tcagactgcacccttaagatcctggactttggcctggcccggaccgcatgcaccaacttt
atgatgactccctatgtggtgacacggtattaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggcgagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcaatggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaaccgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatcggaacgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagaccctgacaagcgcatctccgtggacgaagctttgcgtcacccttac
atcaccgtttggtatgaccccgcagaagcagaagcgccaccacctcagatttacgacgcc
cagttggaagaaagagaacatgcgattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagagagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtgagcagccacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtctcgacgcctcgacgggacccctt
gaaggttgtcgatga

KEGG   Pteropus alecto (black flying fox): 102892777
Entry
102892777         CDS       T02993                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04024  cAMP signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04137  Mitophagy - animal
pale04140  Autophagy - animal
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04530  Tight junction
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04728  Dopaminergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04917  Prolactin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04926  Relaxin signaling pathway
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05231  Choline metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102892777 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102892777 (MAPK8)
   04012 ErbB signaling pathway
    102892777 (MAPK8)
   04014 Ras signaling pathway
    102892777 (MAPK8)
   04310 Wnt signaling pathway
    102892777 (MAPK8)
   04668 TNF signaling pathway
    102892777 (MAPK8)
   04068 FoxO signaling pathway
    102892777 (MAPK8)
   04071 Sphingolipid signaling pathway
    102892777 (MAPK8)
   04024 cAMP signaling pathway
    102892777 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102892777 (MAPK8)
   04137 Mitophagy - animal
    102892777 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102892777 (MAPK8)
   04215 Apoptosis - multiple species
    102892777 (MAPK8)
   04217 Necroptosis
    102892777 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102892777 (MAPK8)
   04530 Tight junction
    102892777 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102892777 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102892777 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102892777 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102892777 (MAPK8)
   04660 T cell receptor signaling pathway
    102892777 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102892777 (MAPK8)
   04659 Th17 cell differentiation
    102892777 (MAPK8)
   04657 IL-17 signaling pathway
    102892777 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102892777 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102892777 (MAPK8)
   04920 Adipocytokine signaling pathway
    102892777 (MAPK8)
   04912 GnRH signaling pathway
    102892777 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102892777 (MAPK8)
   04917 Prolactin signaling pathway
    102892777 (MAPK8)
   04926 Relaxin signaling pathway
    102892777 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    102892777 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102892777 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102892777 (MAPK8)
   04722 Neurotrophin signaling pathway
    102892777 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102892777 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102892777 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892777 (MAPK8)
   05231 Choline metabolism in cancer
    102892777 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102892777 (MAPK8)
   05212 Pancreatic cancer
    102892777 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102892777 (MAPK8)
   05012 Parkinson disease
    102892777 (MAPK8)
   05016 Huntington disease
    102892777 (MAPK8)
   05017 Spinocerebellar ataxia
    102892777 (MAPK8)
   05020 Prion disease
    102892777 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    102892777 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102892777 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102892777 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    102892777 (MAPK8)
   04931 Insulin resistance
    102892777 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102892777 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102892777 (MAPK8)
   05135 Yersinia infection
    102892777 (MAPK8)
   05133 Pertussis
    102892777 (MAPK8)
   05152 Tuberculosis
    102892777 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102892777 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102892777 (MAPK8)
   05161 Hepatitis B
    102892777 (MAPK8)
   05171 Coronavirus disease - COVID-19
    102892777 (MAPK8)
   05162 Measles
    102892777 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102892777 (MAPK8)
   05169 Epstein-Barr virus infection
    102892777 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102892777 (MAPK8)
   05142 Chagas disease
    102892777 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102892777 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102892777 (MAPK8)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102892777 (MAPK8)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102892777 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 102892777
NCBI-ProteinID: XP_006916982
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagtaagcgtgacagcaatttttatagtgtagagattggtgattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaagcgggcttacagagaactagttcttatgaaatgtgtt
aatcacaaaaatataattggcctgttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgctggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcaccagaagtcatcttaggaatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcccgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgattcggaacacaacaaacttaaagccagtcaggcaagggatttgttatctaaa
atgctggttattgatgcatctaaaaggatctctgtagatgaagctctccagcatccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
caattagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaggaagtt
atggacttggaggagagaaccaagaatggagttatacgaggacagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcatctgtcaatgatgtatct
tcaatgtcaacagacccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system