KEGG   Pteropus alecto (black flying fox): 102885092
Entry
102885092         CDS       T02993                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04072  Phospholipase D signaling pathway
pale04136  Autophagy - other
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04371  Apelin signaling pathway
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale04714  Thermogenesis
pale04910  Insulin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05221  Acute myeloid leukemia
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102885092 (MTOR)
   04371 Apelin signaling pathway
    102885092 (MTOR)
   04630 JAK-STAT signaling pathway
    102885092 (MTOR)
   04066 HIF-1 signaling pathway
    102885092 (MTOR)
   04072 Phospholipase D signaling pathway
    102885092 (MTOR)
   04151 PI3K-Akt signaling pathway
    102885092 (MTOR)
   04152 AMPK signaling pathway
    102885092 (MTOR)
   04150 mTOR signaling pathway
    102885092 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102885092 (MTOR)
   04136 Autophagy - other
    102885092 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    102885092 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102885092 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102885092 (MTOR)
   04920 Adipocytokine signaling pathway
    102885092 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    102885092 (MTOR)
   04919 Thyroid hormone signaling pathway
    102885092 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102885092 (MTOR)
   04213 Longevity regulating pathway - multiple species
    102885092 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102885092 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885092 (MTOR)
   05206 MicroRNAs in cancer
    102885092 (MTOR)
   05205 Proteoglycans in cancer
    102885092 (MTOR)
   05230 Central carbon metabolism in cancer
    102885092 (MTOR)
   05231 Choline metabolism in cancer
    102885092 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102885092 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885092 (MTOR)
   05212 Pancreatic cancer
    102885092 (MTOR)
   05225 Hepatocellular carcinoma
    102885092 (MTOR)
   05226 Gastric cancer
    102885092 (MTOR)
   05214 Glioma
    102885092 (MTOR)
   05221 Acute myeloid leukemia
    102885092 (MTOR)
   05215 Prostate cancer
    102885092 (MTOR)
   05224 Breast cancer
    102885092 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885092 (MTOR)
   05014 Amyotrophic lateral sclerosis
    102885092 (MTOR)
   05016 Huntington disease
    102885092 (MTOR)
   05017 Spinocerebellar ataxia
    102885092 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    102885092 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102885092 (MTOR)
   04931 Insulin resistance
    102885092 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102885092 (MTOR)
   05168 Herpes simplex virus 1 infection
    102885092 (MTOR)
   05163 Human cytomegalovirus infection
    102885092 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885092 (MTOR)
   05165 Human papillomavirus infection
    102885092 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885092 (MTOR)
   01522 Endocrine resistance
    102885092 (MTOR)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102885092 (MTOR)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102885092 (MTOR)
Membrane trafficking [BR:pale04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102885092 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 102885092
NCBI-ProteinID: XP_006914423
LinkDB
Position
Unknown
AA seq 2550 aa
MIGTGPAAATTATTTSSNVSILQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMAFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDASASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSTRKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATATSTEGSNSESEAESSENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgattggaaccggacctgctgccgccaccacggccaccaccacatctagcaatgtgagc
attctgcagcagtttgccagtggcctgaagagccggaatgaggaaaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttagagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagttcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggccgatttgcaaattatcttcggaacctcctcccctctaatgatcca
gttgtcatggaaatggcatccaaggccatcggtcgccttgccatggcaggggacactttt
accgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggcgctgaccgc
aatgagggccggagacatgcagctgttctggttctccgtgagctggctatcagcgtcccc
accttcttcttccagcaagtacaacccttctttgacaacatttttgtggctgtgtgggac
cccaaacaggccattcgtgagggcgctgtagctgcccttcgtgcttgcctgattctcact
acccagcgtgagccaaaggagatgcagaagcctcagtggtaccggcatacatttgaagaa
gcagagaaagggtttgatgaaaccttggccaaggagaaaggcatgaatcgagatgatcgg
atccatggagctttgctgatcctcaatgagctggtcagaatcagcagcatggagggagag
cgcctgagggaagaaatggaggaaatcacacagcagcagttggtacatgacaagtactgc
aaagatctcatgggcttcggaacgaaacctcgtcacatcacccccttcaccagtttccag
gctgtacagccccagcagtcaaatgccttggtgggactgctggggtacagctctcaccaa
ggcctgatggcatttggggcttcccccagcccagctaagtccaccctagtggagagtcgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttaccccgcttggct
gcatttcgaccttccgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacgtacagcagccttccaagctctggggctactt
tctgtggctgtgaggtctgaatttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgccccctaaggactttgctcataagagacagaaggcaatgcaggtggatgcc
acagtattcacctgcatcagcatgctggcacgagcaatggggccaggcatccagcaggac
atcaaggagctgctagagcctatgctggccgtgggactgagccccgccctcacagctgtg
ctctacgacctaagccgtcagattccgcagctgaagaaggacatccaggatgggctactg
aagatgctgtcccttgtccttatgcacaaaccccttcggcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacaactctccctgaagccagcgatgtgggc
agcattacccttgccctccgaactcttggcagctttgaatttgaaggacactctctgacc
cagttcgtccgtcactgtgcggatcacttcctgaacagtgaacacaaggagatccgcatg
gaagccgcccgtacctgctctcgcctgctcacgccctccgttcacctcatcagtggccac
gcgcacgtggttagccagacggcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggttgggataacagatcccgaccctgacatccgctactgtgtcttggcatccttggat
gagcgcttcgatgcacatctggcccaggcagagaatttgcaggccctgtttgtagctttg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggtcggctcagtagc
atgaacccagccttcgtcatgcctttcctacgcaagatgctcatccagattttgacagag
ctggagcacagcggtattggaagaatcaaagagcagagtgcccgcatgctggggcatctg
gtctctaatgccccccgactcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttagctcaggtcagtggcctggaaatgaggaaatgggttgatgagctt
tttatcatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtagccagcactggctatgtggtagagccctacaggaag
taccccactttgctagaggtactgctgaatttcctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttagggcttttgggagccttggatccctataagcacaaa
gtgaacatcggcatgattgaccagtcccgggacgcttctgctgtcagcctgtcagagtcc
aagtcaagccaggattcctctgactacagcaccagcgaaatgctggtcaacatggggaac
ctacctctggatgagttttacccagccgtttccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccaccacaccatggttgtccaggccatcacctttatcttcaag
tccctgggcctcaagtgtgtgcagttcctgccccaggtcatgcccacattcctgaacgtc
attcgtgtctgtgacggggccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcgatccagagcacaatcattctcctcattgagcaaattgtg
gtcgctctcgggggtgaatttaagctctatctgccccagcttatcccgcacatgctgcga
gtcttcatgcacgacaacagcccaggccgcatcgtctccatcaagttgttggctgcaatc
cagctgtttggtgccaacctggatgactatctgcatttgttgctgccccccatcgtgaag
ttgtttgatgcccctgaggttccactgccatctcgaaaggcagcgttagagacggtagac
cgcctgaccgagtccctggacttcactgactacgcctcccggatcattcacccgatcgtt
cgaacactggaccagagcccagaactgcgtcccacagccatggacacgttgtcctcactt
gtctttcagctggggaagaagtaccaaattttcattccgatggtgaataaagttctggtg
cgacaccgaatcaaccatcagcgctacgatgtcctcatctgcagaattgtcaagggctac
acccttgccgatgaggaggaggaccctttgatttaccagcatcgaatgctgaggagtggc
caaggggacgcgtcggctagtgggccggtggagacgggacccatgaagaagctgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctggagtggctgaggcggctgagcctggagctgctgaaggactcttcgtcaccctctctg
cgctcatgctgggccctggcccaggcctacaacccaatggccagggatctctttaatgct
gcgtttgtgtcctgctggtctgaactgaatgaagaccaacaggatgaactcatcagaagc
atcgagttggccctcacttcacaggatatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagagacgacaatggcatt
gttttgctgggtgagagggctgccaaatgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggtcccacccctgccatcctagagtctctcatcagtattaat
aataagctacagcagccagaggcagcagctggggtgttagaatatgccatgaaacacttc
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaggacgccctc
gtcgcctatgataagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgcctcgaagccttgggggaatggggacagctccaccagcagtgctgtgagaag
tggaccctggttaacgacgagacccaagccaagatggcccggatggctgctgctgctgcg
tggggtttaggtcaatgggacagcatggaagagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcactacatcaggacctcttctccctggca
caacagtgcattgacaaagccagagacctgctggacgccgagttgactgctatggcagga
gagagctacagtcgggcatatggggccatggtttcttgccacatgctctccgagctggag
gaggttatccagtacaaactcgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtggaggactggcagaagatccttatggtacgg
tcccttgtggtcagccctcatgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagtggcaggctggctctcgctcataaaaccttagtgttactcctgggagtcgat
ccatcccggcaacttgaccatcctctgcccacagttcacccccaggtgacctacgcctac
atgaaaaacatgtggaagagtactcgcaagatcgatgccttccagcacatgcagcacttc
gttcagaccatgcagcagcaagcccagcacgccatcgctactgaggaccagcagcacaag
caggagctgcacaagctcatggcccgctgtttcctgaaactcggggagtggcagctgaac
ctccagggcatcaacgagagcacgatccccaaagtcctgcagtactacagtgccgccaca
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcggtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgacgagaagaagaagctgcgtcacgcc
agcggggccaacatcaccaatgcagctactgccgccaccacagcagccacggccaccgcc
accgccaccagcactgagggcagcaacagcgagagcgaggcagagagcagcgagaacagc
cctacgccatctcctctgcagaagaaggtcaccgaggatttgtccaaaaccctcttgatg
tacaccgtccctgccgtccagggcttcttccgttctatctccttgtcacgaggcaacaac
ctccaggatacactcagagtcctcaccttatggtttgattatggtcactggccagatgta
aacgaagccttggtggaaggggtgaaagcgatccagatcgacacttggttacaggtcata
cctcagctcattgcgagaatcgatacgcccaggccgttggtgggacgtctcattcaccag
cttctcacagacatcggtcggtaccacccgcaggccctcatctaccccctgactgtggct
tctaagtccacaaccacagcacgtcacaacgcagccaacaagattctgaagaacatgtgt
gagcacagtaacaccctggtgcagcaggccatgatggtgagcgaagagctgatccgagtg
gccatcctctggcacgagatgtggcacgaaggcctagaggaagcttctcgtttgtacttt
ggggagaggaacgtgaaaggcatgttcgaggtgctggagcccctgcacgccatgatggaa
cggggaccccagactctgaaggaaacatcctttaaccaggcatacggtcgagatttaatg
gaggcccaagagtggtgcaggaagtacatgaaatcaggaaatgtcaaggacctcacccag
gcctgggacctctactaccacgtgttcagacgcatctccaagcagctgccacagctcaca
tccttagagctgcagtacgtttcccccaaactcctgatgtgccgggaccttgaattggct
gtgccaggaacatatgaccccaaccagccgatcattcgcattcagtccatagcaccatct
ttgcaagtcatcacatccaagcagaggcctcggaagttgacactgatgggcagcaacggg
catgagtttgttttccttctgaagggccatgaggacctacggcaggacgaacgcgtgatg
cagctcttcggcctggtcaacaccctgctggccaacgacccaacctctctgcgaaagaac
ctcagcatccagagatatgcagtcattcctttatcgaccaactcgggcctcatcggctgg
gtcccccactgtgacacactgcatgccctcatccgggactacagagagaagaagaaaatc
ctgctcaacattgagcatcgcatcatgttgcggatggctccggactacgatcacctgacc
ctgatgcagaaggtcgaggtgtttgagcacgcagtcaacaacacggcaggggatgacctg
gccaagctgctgtggctgaaaagcccgagctctgaggtgtggtttgatcgaagaaccaat
tacacccgctctttagcagtcatgtccatggtcggctatattttgggcctaggagacaga
cacccgtccaacctgatgctggaccggctgagtgggaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagagaaaaattcccagagaagattccatttagacta
acgagaatgttgaccaatgctatggaggttactggcctggatggcaactatagaatcaca
tgccacacggtgatggaagtccttcgcgagcacaaggatagcgtcatggccgtgctggaa
gccttcgtctacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcgatcccgaacaaggacagattcctactctgctggccagtcagtagaaattttggat
ggtgtggaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctatt
cattctttcattggagatggtctggtcaaaccagaggccctaaacaagaaagctattcag
attattaacagagttcgagataagctcactggtcgggacttctctcatgatgaaactttg
gatgtcccaacacaagtcgaactgctcatcaaacaagcaacatcccacgaaaacctctgc
cagtgctacattggctggtgccctttctggtaa

DBGET integrated database retrieval system