KEGG   Pteropus alecto (black flying fox): 102885135
Entry
102885135         CDS       T02993                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04071  Sphingolipid signaling pathway
pale04115  p53 signaling pathway
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04722  Neurotrophin signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102885135 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102885135 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102885135 (BAX)
   04215 Apoptosis - multiple species
    102885135 (BAX)
   04217 Necroptosis
    102885135 (BAX)
   04115 p53 signaling pathway
    102885135 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102885135 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    102885135 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885135 (BAX)
   05202 Transcriptional misregulation in cancer
    102885135 (BAX)
   05203 Viral carcinogenesis
    102885135 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885135 (BAX)
   05212 Pancreatic cancer
    102885135 (BAX)
   05225 Hepatocellular carcinoma
    102885135 (BAX)
   05226 Gastric cancer
    102885135 (BAX)
   05214 Glioma
    102885135 (BAX)
   05216 Thyroid cancer
    102885135 (BAX)
   05220 Chronic myeloid leukemia
    102885135 (BAX)
   05217 Basal cell carcinoma
    102885135 (BAX)
   05218 Melanoma
    102885135 (BAX)
   05213 Endometrial cancer
    102885135 (BAX)
   05224 Breast cancer
    102885135 (BAX)
   05222 Small cell lung cancer
    102885135 (BAX)
   05223 Non-small cell lung cancer
    102885135 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102885135 (BAX)
   05014 Amyotrophic lateral sclerosis
    102885135 (BAX)
   05016 Huntington disease
    102885135 (BAX)
   05020 Prion disease
    102885135 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    102885135 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102885135 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885135 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102885135 (BAX)
   05152 Tuberculosis
    102885135 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885135 (BAX)
   05170 Human immunodeficiency virus 1 infection
    102885135 (BAX)
   05161 Hepatitis B
    102885135 (BAX)
   05160 Hepatitis C
    102885135 (BAX)
   05164 Influenza A
    102885135 (BAX)
   05162 Measles
    102885135 (BAX)
   05168 Herpes simplex virus 1 infection
    102885135 (BAX)
   05163 Human cytomegalovirus infection
    102885135 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885135 (BAX)
   05169 Epstein-Barr virus infection
    102885135 (BAX)
   05165 Human papillomavirus infection
    102885135 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885135 (BAX)
   01524 Platinum drug resistance
    102885135 (BAX)
   01522 Endocrine resistance
    102885135 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pale03029]
    102885135 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102885135 (BAX)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102885135 (BAX)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102885135 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 102885135
NCBI-ProteinID: XP_006905111
UniProt: L5L691
LinkDB
Position
Unknown
AA seq 194 aa
MDGSGEQPRDGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEPRGPQDASTKKL
SECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVASEMFSDGNFNWGRVVALFYFASK
LVLKALCTKVPQLIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVTG
MLTASLTVIWKKMG
NT seq 585 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagagacggggggcccaccagctctgagcagatcatg
aagacaggggcccttttacttcagggtttcatccaggatcgagcggggcgaatgggggga
gagacacctgagctggccctggagcccagggggccgcaggatgcatccaccaagaagctg
agcgagtgcctcaagcgcatcggagatgaactggacagtaacatggagctgcagaggatg
attgcagctgtggacacagattccccccgcgaggtctttttccgagtagcgtccgagatg
ttttccgatggcaacttcaactggggccgggttgtcgccttgttctactttgccagcaaa
ctggtgctcaaggccctgtgcaccaaagtgccccagctgataagaaccatcatgggctgg
acactggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggac
ggccttctctcctactttgggacacccacgtggcagacagtgaccattctcgtgaccgga
atgctcactgcctcactaaccgttatctggaagaagatgggctga

DBGET integrated database retrieval system