KEGG   Pteropus alecto (black flying fox): 102885225Help
Entry
102885225         CDS       T02993                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102885225 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102885225 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102885225 (MGST2)
   00983 Drug metabolism - other enzymes
    102885225 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102885225 (MGST2)
   05204 Chemical carcinogenesis
    102885225 (MGST2)
   05225 Hepatocellular carcinoma
    102885225 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102885225 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    102885225 (MGST2)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102885225 (MGST2)
Transporters [BR:pale02000]
 Other Transporters
  Pores ion channels [TC:1]
   102885225 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102885225
NCBI-ProteinID: XP_006906283
LinkDB All DBs
Position
Un
AA seq 111 aa AA seqDB search
MPPAVSGSPEFERIFRAQQNCVEFYPVFLITLWMAGWYFHQVFATCLGLVYIYERYQYFW
GYSEDANKRLTGFRLSLGILALLAVLGSLGIANSFLDEYLHLNIAKKLRHF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagcagtctctgggtcaccagagtttgagagaatatttcgtgcacaacaaaac
tgtgtggaattttaccccgtattcctgattacattgtggatggctggttggtatttccac
caagtttttgctacctgtctgggtctggtgtatatatatgaacgttaccagtatttctgg
ggatattcagaagatgctaacaaaagattgactggtttccggttgagtctggggattttg
gccttgctggctgtcctaggctccctggggattgcaaacagctttctggatgaatacctg
cacctcaatattgccaagaagctgaggcacttctag

DBGET integrated database retrieval system