KEGG   Pteropus alecto (black flying fox): 102885300
Entry
102885300         CDS       T02993                                 

Gene name
ERBB2
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04520  Adherens junction
pale04530  Tight junction
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05219  Bladder cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885300 (ERBB2)
   04012 ErbB signaling pathway
    102885300 (ERBB2)
   04066 HIF-1 signaling pathway
    102885300 (ERBB2)
   04020 Calcium signaling pathway
    102885300 (ERBB2)
   04151 PI3K-Akt signaling pathway
    102885300 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885300 (ERBB2)
   04520 Adherens junction
    102885300 (ERBB2)
   04530 Tight junction
    102885300 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885300 (ERBB2)
   05206 MicroRNAs in cancer
    102885300 (ERBB2)
   05205 Proteoglycans in cancer
    102885300 (ERBB2)
   05230 Central carbon metabolism in cancer
    102885300 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102885300 (ERBB2)
   05226 Gastric cancer
    102885300 (ERBB2)
   05219 Bladder cancer
    102885300 (ERBB2)
   05215 Prostate cancer
    102885300 (ERBB2)
   05213 Endometrial cancer
    102885300 (ERBB2)
   05224 Breast cancer
    102885300 (ERBB2)
   05223 Non-small cell lung cancer
    102885300 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885300 (ERBB2)
   01524 Platinum drug resistance
    102885300 (ERBB2)
   01522 Endocrine resistance
    102885300 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885300 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102885300 (ERBB2)
   04090 CD molecules [BR:pale04090]
    102885300 (ERBB2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102885300 (ERBB2)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102885300 (ERBB2)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102885300 (ERBB2)
CD molecules [BR:pale04090]
 Proteins
  102885300 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 102885300
NCBI-ProteinID: XP_006924762
LinkDB
Position
Unknown
AA seq 1263 aa
MELAAWCRWGLLLALLPPGATGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDSYALAVLDNG
DLLDSATPAAGPAPRGLQELQLRSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LMLIDNNRSRACQPCSPACKASHCWGESSQDCQRLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREARAVTSAN
VLEFAGCKKIFGSLAFLPESFAGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPDTLP
DLSVFQKLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEDECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCVGSGADQCVACAHYKDSPFCVARC
PSGVKPDLSFMPIWKFPDEKGTCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
TLLVMVMGVVFGILIRRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQXXXXXXXXXXXXXWCVQIAK
GMSYLEEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMAL
ESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDV
YMIMVKCWMIDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLED
DDMGDLVDAEEYLVPQQGFFCPDPVPGTGGTAHHRHRSSSTRSGGGELTLGLEPPEEEPP
KSPLAPSEGAGSDVFDSDLGVGAAKGLQTLSPHDPSPLQRYSEDPTVPLPPETDGYVAPL
TCSPQPEYVNQPEVRPQPPSPLDGPLTPRPAGATLERPKTLSPGKNGVVKDVFAFGGAVE
NPEYLAPRGKAASQPQPPPAFSPAFDNLYYWDQDPSERSSPPSTFEGTPTAENPEYLGLD
VPV
NT seq 3792 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctccttctcgccctcctgccccccggagcc
acgggcactcaagtgtgcactggcacagatatgaagctgcggctcccagccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcaggggaacctg
gaacttacctacctgcctgccaatgccagcctctctttcctacaggatatccaggaggta
cagggttatgtgctcatcgctcacaaccaagtgagacaggtcccactgcagaggctgcgc
atcgtgcgaggcacccagctatttgaggatagctatgccctggccgtgctggacaatgga
gaccttctggacagtgccacccctgctgctgggcctgccccaagaggactgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggggtgttgatccagcggaaccctcag
ctctgccaccaggatacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcatgctgatagacaacaaccgctcccgggcctgccaaccctgttctccagcttgtaaa
gcctctcactgctggggagaaagttcccaggattgtcagcgcttgacgcgaactgtctgt
gccggcggctgtgcccgatgcaagggcccgctgcccaccgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacggacaccttcgag
tccatgcccaaccctgagggccggtatacctttggcgccagctgtgtgaccgcctgtccc
tacaactacctatcgacggatgtgggatcctgcaccctagtctgtccccttaacaaccaa
gaagtgacagctgaagacggaacacagcggtgtgagaaatgcagcaagccttgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggcgagggcggtcactagtgccaat
gtcctggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgcgggggacccagcctccaacactgcccccctacagcccgagcagctcagagtgttt
gagaccttagaggagattacaggttacctgtacatctcagcgtggccagacaccctgcct
gacctcagtgtcttccagaaactgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaaggcctgggcatcagctggctggggctgcgctcactgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtgcacacggtg
ccctgggaccagctctttcggaaccctcaccaggccctgctccacagtgctaaccgccca
gaggacgagtgtgtgggtgaaggcctggcctgctacccgctgtgtgcccatgggcactgc
tggggtccgggacccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggagtgccgagtactgcaggggctcccccgggagtatgtgaaggacaggtactgt
ctgccgtgccaccccgagtgtcaaccccagaatggctcagtgacctgcgtaggatcgggg
gctgaccagtgtgtggcctgcgcccactacaaggactctcccttctgcgtggctcgctgc
cccagtggtgtgaaacctgacctctccttcatgcccatctggaagttcccagatgagaag
ggcacgtgccagccgtgccccatcaactgcacccactcctgtgtggacctggatgacaag
gggtgtcccgccgagcagagagccagccctgtgacgtctatcattgctgctgtggtgggc
actctgctggtcatggttatgggggtagttttcggcatcctaatcaggcgaaggaggcag
aagatccggaagtacacgatgagaaggctgctgcaggaaacagagctggtggagccgttg
acacctagtggagcgatgcccaaccaggctcagatgcggattctaaaagagacagagctg
aggaaggtgaaggtgcttggatcaggagcttttggcacagtctacaagggcatctggatc
cccgatggggagaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatct
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgttggctcccca
tatgtctcgcgcctcctgggcatctgcctgacctctacggtgcagttggtgacacagctt
atgccctacggctgccttctagaccacgtccgggaacaccgtggacgcctgggctcacag
gnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnactggtgtgtgcagattgcaaag
gggatgagctacttggaggaagtgcggcttgtgcacagggacctggctgcccggaatgtg
ctggtcaagagtcctaaccatgtcaagatcacagactttgggctggctcggctgttggac
attgacgagacagagtaccatgcagatgggggcaaggtgcccatcaagtggatggcgttg
gagtccattctccgccgacggttcacccaccagagtgatgtgtggagctacggtgtgact
gtatgggagctgatgacttttggggccaaaccttacgatgggatcccagctcgggagatc
cctgacctgctggagaagggggaacggctgccccagccccccatctgcaccatcgatgtc
tacatgatcatggtcaaatgttggatgattgactctgagtgtcggcctcggttccgggag
ttggtggccgaattctcccgcatggccagggacccccagcgctttgtggtcatccagaat
gaggacctgggccctgccagccccttggacagcaccttctaccgctcgctgctggaggat
gacgacatgggggacctggtggatgcggaggagtacctggtgccccagcagggcttcttt
tgcccagatcctgttccgggtactgggggcacagcccaccacaggcaccgcagctcatcc
accaggagtggcggtggtgagctgacactggggctggagccccccgaagaggagcccccc
aagtctccactggcaccctcagaaggggcaggctctgatgtgtttgacagcgatttggga
gtgggggcagccaagggactgcaaactctctccccacatgaccccagccctctacagcgg
tacagtgaggaccccacggtacccttgcctcctgaaactgacggctacgttgcccccctg
acctgcagcccccagcccgaatatgtgaaccagccagaggttcgcccacagcccccctca
cccctagatggccccctgactcctcgacctgctggtgccacgctggaaaggcccaagact
ctctctcctgggaagaatggggttgtcaaagatgtttttgcctttgggggtgccgtggag
aaccccgagtacttggcaccccgtggcaaggctgcttctcagccccaacctcctccagcc
ttcagtccagcttttgataacctctattactgggaccaggacccatcagagcggagctct
ccacctagcacctttgaagggacccctacggcagagaaccctgaatacctgggactggat
gtgccagtgtga

DBGET integrated database retrieval system