KEGG   Pteropus alecto (black flying fox): 102885330
Entry
102885330         CDS       T02993                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04340  Hedgehog signaling pathway
pale04371  Apelin signaling pathway
pale04390  Hippo signaling pathway
pale04510  Focal adhesion
pale04530  Tight junction
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102885330 (CCND1)
   04340 Hedgehog signaling pathway
    102885330 (CCND1)
   04390 Hippo signaling pathway
    102885330 (CCND1)
   04371 Apelin signaling pathway
    102885330 (CCND1)
   04630 JAK-STAT signaling pathway
    102885330 (CCND1)
   04068 FoxO signaling pathway
    102885330 (CCND1)
   04151 PI3K-Akt signaling pathway
    102885330 (CCND1)
   04152 AMPK signaling pathway
    102885330 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102885330 (CCND1)
   04115 p53 signaling pathway
    102885330 (CCND1)
   04218 Cellular senescence
    102885330 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885330 (CCND1)
   04530 Tight junction
    102885330 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102885330 (CCND1)
   04921 Oxytocin signaling pathway
    102885330 (CCND1)
   04919 Thyroid hormone signaling pathway
    102885330 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885330 (CCND1)
   05206 MicroRNAs in cancer
    102885330 (CCND1)
   05205 Proteoglycans in cancer
    102885330 (CCND1)
   05203 Viral carcinogenesis
    102885330 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885330 (CCND1)
   05212 Pancreatic cancer
    102885330 (CCND1)
   05225 Hepatocellular carcinoma
    102885330 (CCND1)
   05226 Gastric cancer
    102885330 (CCND1)
   05214 Glioma
    102885330 (CCND1)
   05216 Thyroid cancer
    102885330 (CCND1)
   05221 Acute myeloid leukemia
    102885330 (CCND1)
   05220 Chronic myeloid leukemia
    102885330 (CCND1)
   05218 Melanoma
    102885330 (CCND1)
   05219 Bladder cancer
    102885330 (CCND1)
   05215 Prostate cancer
    102885330 (CCND1)
   05213 Endometrial cancer
    102885330 (CCND1)
   05224 Breast cancer
    102885330 (CCND1)
   05222 Small cell lung cancer
    102885330 (CCND1)
   05223 Non-small cell lung cancer
    102885330 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102885330 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885330 (CCND1)
   04934 Cushing syndrome
    102885330 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885330 (CCND1)
   05162 Measles
    102885330 (CCND1)
   05160 Hepatitis C
    102885330 (CCND1)
   05163 Human cytomegalovirus infection
    102885330 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885330 (CCND1)
   05169 Epstein-Barr virus infection
    102885330 (CCND1)
   05165 Human papillomavirus infection
    102885330 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102885330 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102885330
NCBI-ProteinID: XP_006911059
UniProt: L5KNC8
LinkDB
Position
Unknown
AA seq 296 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSSSFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEEADLACTPTDVRDVNI
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctccgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgcgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtctctggagccggtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gaactgctgctggtgaacaaactcaagtggaacctggctgccatgaccccgcacgatttc
atcgaacacttcctctctaagatgccggtggccgaggagaacaagcagatcatacgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatctccaacccgccg
tccatggtggccgcagggagcgtggtggctgcagtgcaaggcctgcacctggggagttcc
agcagcttcctgtcctaccaccgcctcacgcgattcctctccaaagtgattaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggccgcggaggaggaggaggaggaggaggag
gaggccgacctggcctgcacgcccactgacgtgcgggacgtgaacatctga

DBGET integrated database retrieval system