KEGG   Pteropus alecto (black flying fox): 102885522Help
Entry
102885522         CDS       T02993                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04621  NOD-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale05152  Tuberculosis
pale05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102885522 (CARD9)
   04625 C-type lectin receptor signaling pathway
    102885522 (CARD9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102885522 (CARD9)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102885522 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 CxC5
Motif
Other DBs
NCBI-GeneID: 102885522
NCBI-ProteinID: XP_024907056
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MSDYENEDACWSTLEGFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPSRVFSMIIDASGESGLTQLLM
SEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEACGRELKRYKD
ENYDLAMRLARQSEDRGAALMRNRDLQLEIDRLKHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWELQQEKALLQARVQELEASAQEGKLDRSSPYIQVLEEDWRQALRDHQEQANT
IFALRKDLRQGEALRARCMEEKEMFELQCLALRKDSKMYKDRIEAILQQMEEVAVERDQA
IASREELHARYAQSLQDKDALRKRVRELGGKADELQLQLFQREAQLLAAEGQLKRQQLEM
LVLSSDLEDSSPRNSQELSPPQDLEEDTQLSDKGGPAEGESPEQPFVALQKDRLSLTPND
SGLGGGEPPEKERRRLKESFENYRRKRALRKMQHGSRQGEVDWENTTGSDNTDTEGS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactacgagaacgaggatgcgtgctggagcacactggagggcttcagggtgaag
ctcatctcggtcatcgacccctcgcgcatcactccctacctgcggcagtgcaaagtcctg
aaccccgacgacgaggagcaggtgctcagcgaccccaacctcgtcatccgcaagcggaaa
gtgggcgtactcctggacatcctgcagcggaccggccacaagggctatgtggccttcctc
gagagcctggagctctactatccgcaactctacaagaaggtcacgggcaaggagccctcc
cgcgtcttctccatgatcatcgacgcgtccggggagtcgggcctgacgcagctcctgatg
agcgaggtcatgaagctgcagaagaaggtgcaggacctgacggcgctgctgagctccaag
gacgacttcatcaaggagctgcgggtcaaggacagcctgctgcgcaagcaccaggagcgc
gtgcagaggctcaaggaggagtgcgaggcctgcggccgcgagctcaagcgctacaaggac
gagaactacgacctggccatgcgcctggcccgccagagcgaggacaggggcgccgcgctc
atgcgcaaccgcgacctgcagctggagatcgaccggctgaagcacagcctgatgaaggcg
gaggacgactgcaaggtggagcgcaagcacacgctgaagctgcggcacgccatggagcag
cggcccagccaggagctgctgtgggagctgcagcaggaaaaggccctgctgcaggcccgg
gtgcaggagctggaggcctctgcccaggaggggaagctggacaggagcagcccctacatc
caggtgctggaggaggactggcggcaggctctgcgggaccaccaggagcaggccaacacc
atcttcgccctgcgcaaagacctgcgccagggggaggccctgcgcgcccggtgcatggag
gagaaggagatgtttgagctgcagtgcctggccctgcggaaggactccaagatgtacaag
gaccgcatcgaggccatcctgcagcagatggaggaggtcgccgtcgagcgggaccaggcc
atcgcgtcgcgggaggagctgcacgcccgctacgcccagagcctgcaggacaaggacgca
cttcgcaagcgagtgcgggagctgggcgggaaggccgacgagctgcagctgcagctgttc
cagcgcgaggcccagctgctggccgcggagggccagctcaagcggcagcagctggagatg
ctggtcctgagctccgacctggaggacagctcacccaggaactcccaggaactgtcgccc
ccccaggacctggaggaggacacccagctctcagacaaaggaggcccggccgaaggggag
agcccagagcagccctttgtggccctgcagaaggaccggctttcactgacccccaatgac
tcaggcctgggcggcggggagccccccgagaaagagcggcgacgcctcaaggagagcttt
gagaactaccgcaggaagcgggcgcttcggaagatgcagcacggctcgagacagggcgag
gtggactgggagaacaccacgggcagcgacaacaccgacaccgagggctcctag

DBGET integrated database retrieval system