KEGG   Pteropus alecto (black flying fox): 102885620
Entry
102885620         CDS       T02993                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04066  HIF-1 signaling pathway
pale04911  Insulin secretion
pale04919  Thyroid hormone signaling pathway
pale04920  Adipocytokine signaling pathway
pale04922  Glucagon signaling pathway
pale04931  Insulin resistance
pale04976  Bile secretion
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05211  Renal cell carcinoma
pale05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102885620 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102885620 (SLC2A1)
   04922 Glucagon signaling pathway
    102885620 (SLC2A1)
   04920 Adipocytokine signaling pathway
    102885620 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    102885620 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    102885620 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885620 (SLC2A1)
   05230 Central carbon metabolism in cancer
    102885620 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102885620 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102885620 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885620 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102885620 (SLC2A1)
Transporters [BR:pale02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   102885620 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    102885620 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF523
Other DBs
NCBI-GeneID: 102885620
NCBI-ProteinID: XP_006904068
UniProt: L5L8D1
LinkDB
Position
Unknown
AA seq 492 aa
MDPNSKKLTGRLMMAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYAESISPAT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMINLLAFMSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVIGILIAQVFGLDSLM
GNKELWPLLLSIIFIPAMLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMGGCAVLMTIALALLEQ
LPQMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatcccaacagcaagaagctgacaggccgcctcatgatggccgtgggaggggcagtg
cttggctccctgcagtttggctacaacactggagttatcaatgccccgcagaaggtgatt
gaggagttctacaaccagacatggatccaccgctatgcagagagcatctcacccgctacg
ctcaccacactctggtccctctccgtggccatcttctctgtgggaggcatgattggctcc
ttctcggtgggcctttttgttaaccgctttggccggcggaactcgatgctgatgataaac
ctgctggccttcatgtctgctgtgctcatgggcttctcaaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtcggggaggtgtccccgacagcccttagaggggcgctgggcaccctgcac
caactgggcatcgtcatcggcatcctcattgcccaggtgtttggcctggactctctcatg
ggaaacaaggagctgtggcccctgctgctgagcatcatcttcatcccggccatgctgcag
tgcatcctgctgcccttctgccctgagagcccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctgaagaagctgagagggacggcggatgtgacccgagac
cttcaggagatgaaggaggagagtcgtcagatgatgcgggagaagaaagtcaccatcctg
gagctgttccgctcgcccgcctaccgccagcccatcctcatcgctgtggtgttgcagctg
tcccagcagctgtcgggcatcaatgctgttttctattattccacaagcatctttgagaag
gcaggggtgcaacagcctgtgtatgccaccatcggttccgggatcgtcaacacagccttc
acggtcgtatcgctctttgtggtggaacgagctggccggcggaccctgcacctcattggc
ctggctggcatgggaggctgtgccgtgctcatgaccattgcgctggcactgctggagcag
ctgccccagatgtcctatctgagcatcgtagccatctttggctttgtggccttcttcgaa
gtgggtcctggccccatcccgtggtttattgtggctgaactctttagccaaggtcctcgc
cctgctgccattgctgttgctggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctatgtcttcatcatcttcaccgtgctc
ctggttctattcttcatcttcacctacttcaaagttcccgagaccaaaggccggaccttc
gatgagattgcttccggtttccggcaggggggagccagccaaagtgacaagacacctgag
gagctgttccaccccctgggggctgattctcaagtgtga

DBGET integrated database retrieval system