KEGG   Pteropus alecto (black flying fox): 102885716
Entry
102885716         CDS       T02993                                 

Gene name
PTTG1
Definition
(RefSeq) securin isoform X1
  KO
K06635  securin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102885716 (PTTG1)
   04114 Oocyte meiosis
    102885716 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885716 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102885716 (PTTG1)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    102885716 (PTTG1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 102885716
NCBI-ProteinID: XP_006906541
LinkDB
Position
Unknown
AA seq 202 aa
MATLIFVDKENGEPRTRVAPKDRLKQASGSSVKALDGRTQDSTPHVGKMFGAPPALPKAA
RKALGTVNRATEKSVKTNGPLKQKQTTFSAKKVTEKTVKAKTSVPASDDAYPEIEKFFPF
NPLDFESFDLPEEHQIAQLPLNGVPLMILEEERELEKLLHLGPPSPLKMPPPLWESNPLP
SPSSILSTLDVELPPVCYDLDV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctactctgatctttgttgataaggaaaatggagaaccaaggacccgtgtggctcct
aaggaccggctgaagcaggcatctgggtcttcagtcaaagctctagatgggagaactcag
gattcaacaccgcatgttggcaaaatgtttggtgctccaccagccttacctaaagctgcc
agaaaggctttgggaactgtcaacagagctacagaaaagtcagtaaagactaatggacct
ctcaaacagaaacagacaaccttctctgccaaaaaggtgacggagaaaaccgttaaagcc
aaaacctccgttcctgcttcagatgacgcctatccagaaatagaaaaattctttcccttc
aatcctctagatttcgagagttttgacttgcctgaagagcaccagattgcacagctcccc
ttgaatggagtgcctctcatgatcctcgaagaagagagagaactcgaaaagcttttacac
ttgggccctccttctcctctgaagatgccccctccactgtgggagtctaatccgttgccg
tctccctcaagcattctgtcgactctggatgttgaattgccacctgtttgctatgactta
gatgtttaa

DBGET integrated database retrieval system