KEGG   Pteropus alecto (black flying fox): 102885749
Entry
102885749         CDS       T02993                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04350  TGF-beta signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04520  Adherens junction
pale04540  Gap junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885749 (MAPK3)
   04012 ErbB signaling pathway
    102885749 (MAPK3)
   04014 Ras signaling pathway
    102885749 (MAPK3)
   04015 Rap1 signaling pathway
    102885749 (MAPK3)
   04350 TGF-beta signaling pathway
    102885749 (MAPK3)
   04370 VEGF signaling pathway
    102885749 (MAPK3)
   04371 Apelin signaling pathway
    102885749 (MAPK3)
   04668 TNF signaling pathway
    102885749 (MAPK3)
   04066 HIF-1 signaling pathway
    102885749 (MAPK3)
   04068 FoxO signaling pathway
    102885749 (MAPK3)
   04072 Phospholipase D signaling pathway
    102885749 (MAPK3)
   04071 Sphingolipid signaling pathway
    102885749 (MAPK3)
   04024 cAMP signaling pathway
    102885749 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102885749 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102885749 (MAPK3)
   04150 mTOR signaling pathway
    102885749 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102885749 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102885749 (MAPK3)
   04210 Apoptosis
    102885749 (MAPK3)
   04218 Cellular senescence
    102885749 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885749 (MAPK3)
   04520 Adherens junction
    102885749 (MAPK3)
   04540 Gap junction
    102885749 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102885749 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102885749 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102885749 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102885749 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102885749 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102885749 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102885749 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102885749 (MAPK3)
   04660 T cell receptor signaling pathway
    102885749 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102885749 (MAPK3)
   04659 Th17 cell differentiation
    102885749 (MAPK3)
   04657 IL-17 signaling pathway
    102885749 (MAPK3)
   04662 B cell receptor signaling pathway
    102885749 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102885749 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102885749 (MAPK3)
   04062 Chemokine signaling pathway
    102885749 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102885749 (MAPK3)
   04929 GnRH secretion
    102885749 (MAPK3)
   04912 GnRH signaling pathway
    102885749 (MAPK3)
   04915 Estrogen signaling pathway
    102885749 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102885749 (MAPK3)
   04917 Prolactin signaling pathway
    102885749 (MAPK3)
   04921 Oxytocin signaling pathway
    102885749 (MAPK3)
   04926 Relaxin signaling pathway
    102885749 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102885749 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102885749 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102885749 (MAPK3)
   04916 Melanogenesis
    102885749 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102885749 (MAPK3)
   04270 Vascular smooth muscle contraction
    102885749 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102885749 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102885749 (MAPK3)
   04725 Cholinergic synapse
    102885749 (MAPK3)
   04726 Serotonergic synapse
    102885749 (MAPK3)
   04720 Long-term potentiation
    102885749 (MAPK3)
   04730 Long-term depression
    102885749 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102885749 (MAPK3)
   04722 Neurotrophin signaling pathway
    102885749 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102885749 (MAPK3)
   04380 Osteoclast differentiation
    102885749 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102885749 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885749 (MAPK3)
   05206 MicroRNAs in cancer
    102885749 (MAPK3)
   05205 Proteoglycans in cancer
    102885749 (MAPK3)
   05203 Viral carcinogenesis
    102885749 (MAPK3)
   05230 Central carbon metabolism in cancer
    102885749 (MAPK3)
   05231 Choline metabolism in cancer
    102885749 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102885749 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885749 (MAPK3)
   05212 Pancreatic cancer
    102885749 (MAPK3)
   05225 Hepatocellular carcinoma
    102885749 (MAPK3)
   05226 Gastric cancer
    102885749 (MAPK3)
   05214 Glioma
    102885749 (MAPK3)
   05216 Thyroid cancer
    102885749 (MAPK3)
   05221 Acute myeloid leukemia
    102885749 (MAPK3)
   05220 Chronic myeloid leukemia
    102885749 (MAPK3)
   05218 Melanoma
    102885749 (MAPK3)
   05211 Renal cell carcinoma
    102885749 (MAPK3)
   05219 Bladder cancer
    102885749 (MAPK3)
   05215 Prostate cancer
    102885749 (MAPK3)
   05213 Endometrial cancer
    102885749 (MAPK3)
   05224 Breast cancer
    102885749 (MAPK3)
   05223 Non-small cell lung cancer
    102885749 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885749 (MAPK3)
   05020 Prion disease
    102885749 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102885749 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102885749 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102885749 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885749 (MAPK3)
   04934 Cushing syndrome
    102885749 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102885749 (MAPK3)
   05135 Yersinia infection
    102885749 (MAPK3)
   05133 Pertussis
    102885749 (MAPK3)
   05152 Tuberculosis
    102885749 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885749 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102885749 (MAPK3)
   05161 Hepatitis B
    102885749 (MAPK3)
   05160 Hepatitis C
    102885749 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102885749 (MAPK3)
   05164 Influenza A
    102885749 (MAPK3)
   05163 Human cytomegalovirus infection
    102885749 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885749 (MAPK3)
   05165 Human papillomavirus infection
    102885749 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102885749 (MAPK3)
   05140 Leishmaniasis
    102885749 (MAPK3)
   05142 Chagas disease
    102885749 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885749 (MAPK3)
   01524 Platinum drug resistance
    102885749 (MAPK3)
   01522 Endocrine resistance
    102885749 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885749 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102885749 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102885749 (MAPK3)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102885749 (MAPK3)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102885749 (MAPK3)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102885749 (MAPK3)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102885749 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 102885749
NCBI-ProteinID: XP_006914289
LinkDB
Position
Unknown
AA seq 395 aa
MDGITHRRDERAWLREAQLSKGLGGGGGEPRGADGVGPGVSGEVEIVKGQPFDVGPRYTQ
LQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFHHENVIGIR
DILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLH
RDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTK
SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL
PSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEE
PFTFDMELDDLPKERLKELIFQETARFQPGVLEAH
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggacgggatcactcatcgtcgggacgagcgagcctggctcagggaggcccaactctct
aaagggctggggggcgggggcggggagccccggggagctgatggggtcggcccgggggtc
tctggggaagtggagatagtgaaggggcagccgttcgacgtgggcccgcgctacacgcaa
ctgcagtacatcggcgagggcgcctatggcatggtcagctcagcttacgaccatgtgcgc
aagacacgcgtagccatcaagaaaatcagccccttcgagcatcagacctactgccagcgc
acactgcgggagatccagatcttgctgcgcttccaccatgagaatgtcattggcatccga
gatattctgcgtgcacccaccctggaagccatgagggatgtctacattgtgcaggacctg
atggagacagacctgtacaagttgctcaaaagccagcagctgagcaacgaccatgtctgc
tacttcctctaccagatcctgcggggcctcaagtatattcactcagccaacgtactccac
cgggatttaaagccctccaacctgctcatcaacaccacctgcgaccttaagatctgcgat
tttggcctggcccggatcgccgatcctgagcatgaccacactggattcctgacagaatac
gtggccacacgctggtaccgggccccagagatcatgcttaactccaagggctacaccaag
tccatcgacatctggtctgtaggctgcattctggctgagatgctctccaaccggcccatc
ttccctggcaagcactacctggaccagctcaaccatattctgggtatcctgggctcccca
tctcaggaggacctgaattgtatcatcaacatgaaggcccgaaactacctacagtctctg
ccctccaagaccaaggtggcctgggccaagctttttcccaagtcagactccaaagccctt
gatctgctggaccggatgttgacctttaaccccaataaacggatcacagtggaagaagcc
ttggctcacccctacttggagcagtactatgacccaacagatgagccggtggctgaggaa
cctttcaccttcgacatggagctcgatgatctacccaaggagcggctgaaggagctcata
ttccaggagacagcccgcttccagcctggggtgctggaggcccactaa

KEGG   Pteropus alecto (black flying fox): 102895390
Entry
102895390         CDS       T02993                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04350  TGF-beta signaling pathway
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04520  Adherens junction
pale04540  Gap junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04668  TNF signaling pathway
pale04713  Circadian entrainment
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04930  Type II diabetes mellitus
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04960  Aldosterone-regulated sodium reabsorption
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895390 (MAPK1)
   04012 ErbB signaling pathway
    102895390 (MAPK1)
   04014 Ras signaling pathway
    102895390 (MAPK1)
   04015 Rap1 signaling pathway
    102895390 (MAPK1)
   04350 TGF-beta signaling pathway
    102895390 (MAPK1)
   04370 VEGF signaling pathway
    102895390 (MAPK1)
   04371 Apelin signaling pathway
    102895390 (MAPK1)
   04668 TNF signaling pathway
    102895390 (MAPK1)
   04066 HIF-1 signaling pathway
    102895390 (MAPK1)
   04068 FoxO signaling pathway
    102895390 (MAPK1)
   04072 Phospholipase D signaling pathway
    102895390 (MAPK1)
   04071 Sphingolipid signaling pathway
    102895390 (MAPK1)
   04024 cAMP signaling pathway
    102895390 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102895390 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102895390 (MAPK1)
   04150 mTOR signaling pathway
    102895390 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102895390 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102895390 (MAPK1)
   04210 Apoptosis
    102895390 (MAPK1)
   04218 Cellular senescence
    102895390 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102895390 (MAPK1)
   04520 Adherens junction
    102895390 (MAPK1)
   04540 Gap junction
    102895390 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102895390 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102895390 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102895390 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102895390 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102895390 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102895390 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102895390 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102895390 (MAPK1)
   04660 T cell receptor signaling pathway
    102895390 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102895390 (MAPK1)
   04659 Th17 cell differentiation
    102895390 (MAPK1)
   04657 IL-17 signaling pathway
    102895390 (MAPK1)
   04662 B cell receptor signaling pathway
    102895390 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102895390 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102895390 (MAPK1)
   04062 Chemokine signaling pathway
    102895390 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102895390 (MAPK1)
   04929 GnRH secretion
    102895390 (MAPK1)
   04912 GnRH signaling pathway
    102895390 (MAPK1)
   04915 Estrogen signaling pathway
    102895390 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102895390 (MAPK1)
   04917 Prolactin signaling pathway
    102895390 (MAPK1)
   04921 Oxytocin signaling pathway
    102895390 (MAPK1)
   04926 Relaxin signaling pathway
    102895390 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102895390 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102895390 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102895390 (MAPK1)
   04916 Melanogenesis
    102895390 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102895390 (MAPK1)
   04270 Vascular smooth muscle contraction
    102895390 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102895390 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102895390 (MAPK1)
   04725 Cholinergic synapse
    102895390 (MAPK1)
   04726 Serotonergic synapse
    102895390 (MAPK1)
   04720 Long-term potentiation
    102895390 (MAPK1)
   04730 Long-term depression
    102895390 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102895390 (MAPK1)
   04722 Neurotrophin signaling pathway
    102895390 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102895390 (MAPK1)
   04380 Osteoclast differentiation
    102895390 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102895390 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895390 (MAPK1)
   05206 MicroRNAs in cancer
    102895390 (MAPK1)
   05205 Proteoglycans in cancer
    102895390 (MAPK1)
   05203 Viral carcinogenesis
    102895390 (MAPK1)
   05230 Central carbon metabolism in cancer
    102895390 (MAPK1)
   05231 Choline metabolism in cancer
    102895390 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102895390 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102895390 (MAPK1)
   05212 Pancreatic cancer
    102895390 (MAPK1)
   05225 Hepatocellular carcinoma
    102895390 (MAPK1)
   05226 Gastric cancer
    102895390 (MAPK1)
   05214 Glioma
    102895390 (MAPK1)
   05216 Thyroid cancer
    102895390 (MAPK1)
   05221 Acute myeloid leukemia
    102895390 (MAPK1)
   05220 Chronic myeloid leukemia
    102895390 (MAPK1)
   05218 Melanoma
    102895390 (MAPK1)
   05211 Renal cell carcinoma
    102895390 (MAPK1)
   05219 Bladder cancer
    102895390 (MAPK1)
   05215 Prostate cancer
    102895390 (MAPK1)
   05213 Endometrial cancer
    102895390 (MAPK1)
   05224 Breast cancer
    102895390 (MAPK1)
   05223 Non-small cell lung cancer
    102895390 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102895390 (MAPK1)
   05020 Prion disease
    102895390 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102895390 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102895390 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102895390 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102895390 (MAPK1)
   04934 Cushing syndrome
    102895390 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102895390 (MAPK1)
   05135 Yersinia infection
    102895390 (MAPK1)
   05133 Pertussis
    102895390 (MAPK1)
   05152 Tuberculosis
    102895390 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895390 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102895390 (MAPK1)
   05161 Hepatitis B
    102895390 (MAPK1)
   05160 Hepatitis C
    102895390 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102895390 (MAPK1)
   05164 Influenza A
    102895390 (MAPK1)
   05163 Human cytomegalovirus infection
    102895390 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895390 (MAPK1)
   05165 Human papillomavirus infection
    102895390 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102895390 (MAPK1)
   05140 Leishmaniasis
    102895390 (MAPK1)
   05142 Chagas disease
    102895390 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895390 (MAPK1)
   01524 Platinum drug resistance
    102895390 (MAPK1)
   01522 Endocrine resistance
    102895390 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102895390 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102895390 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102895390 (MAPK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102895390 (MAPK1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102895390 (MAPK1)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102895390 (MAPK1)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102895390 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 102895390
NCBI-ProteinID: XP_024900234
LinkDB
Position
Unknown
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaagatgtatatatagtgcaggacctcatggaaacagatctctacaagctcttgaag
acacaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aagtatatccattcagctaatgtgctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgtgatctcaagatctgtgattttggcttggcccgtgttgcagatccagac
catgatcacacagggttcctgacggagtatgtagccacacgttggtacagggctccagaa
attatgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcatt
ctggcagagatgctctccaacaggcctatcttccctgggaagcactatctcgaccagctg
aaccacattctgggtattcttggatccccatcacaggaagacctgaattgcataatcaat
ttaaaagctagaaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ttgttcccaaatgctgactccaaagctctggatttactggacaaaatgttgactttcaac
cctcacaagaggattgaagtggaacaggcgctggcccacccatatctggagcagtattat
gacccaagtgatgagcccattgctgaagcaccgttcaagtttgacatggaattggatgac
ttgcctaaggagaagctcaaagaactcatttttgaagagactgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system