KEGG   Pteropus alecto (black flying fox): 102885829Help
Entry
102885829         CDS       T02993                                 

Gene name
GAA
Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00052  Galactose metabolism
pale00500  Starch and sucrose metabolism
pale01100  Metabolic pathways
pale04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102885829 (GAA)
   00500 Starch and sucrose metabolism
    102885829 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102885829 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102885829 (GAA)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102885829 (GAA)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102885829 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102885829
NCBI-ProteinID: XP_006912229
LinkDB All DBs
Position
Unknown
AA seq 941 aa AA seqDB search
MPWPLCSRPQLGLCALLSLAAAAFLGHILLHDFAVVPRELYSFSQVSEEMDQGCQQGAGG
PRPQPSPGAAPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYVPARWRSGESQMGQPWCF
VPPSYPSYKLGNLTTTDTGYTASLTRDSPTFFPKDILTLRLEVLMETESRLHFTIKDPAN
RRYEVPWETPRTRRRAPSSLYSVEFSEEPFGLVVRRKLDGRVLLNTTVAPLFFADQFLQL
STSLPSQHITGLAEHLGPLMLSTNWTKITLWNRDIAPVPDVNLYGSHPFYLALEDGGLAH
GVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPDPKSVVRQYLDIVGYPFMPPYWG
LGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDAKRDFTFNKDGFGDFPAMV
QELHQSGRRYVMIVDPAISSAGPPGSYRPYDEGLRRRVFITNETGQPLIGKVWPGPTAFP
DFTNPETLDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPANDLENPPYVPGVA
GGTLRAATICASSRQLLSTHYNLHNLYGLTEAVASHRALVKTRGTRPFVISRSTFAGHGR
YAGHWTGDVQSSWEQLSSSVPEILLFNLLGVPLVGADVCGFLGDTSEELCVRWTQLGAFY
PFMRNHNDLHSQPQEPYRFSEAAQQAMRKALALRYALLPHXFLGAHARGETVARPLFLEF
PEDPSTWTVDRQLLWGEALLVTPVLEAGKVEVTGYFPSGTWYDLQTVPVEALGSLPPPPP
APLKSAVHSKGQWVTLSAPLDTINLHLRAGHIIPLQGPGLSTTESRKQPMALAVALTGSG
EARGELFWDDGESLGALERGAYTQLVFLARNNTIVNELVHVTGEGAGLQLRKVTVLGVAT
APQQVVSNGVPVSNFTYNPDSQTLAIPVSLALGEQFLISWS
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggccgctctgctcccgcccccagctggggctctgcgccctcctctccctggct
gccgctgccttcctggggcacatcttgctccacgattttgccgtggtcccccgagagctg
tacagcttctcccaagtatccgaggagatggatcaaggttgccagcagggggctggcggc
ccaaggccccagcccagtcctggagcagcacccacacagtgcgacgtgccccccaacagc
cgctttgactgcgccccagacaaggccatcacccaggagcagtgtgaggcccggggctgc
tgctatgtgcccgcgaggtggagatctggagaatcccagatggggcagccctggtgcttc
gtcccacccagctaccccagttacaagctggggaacctgaccaccacagacacgggctac
acagccagcctgacccgagacagcccgaccttcttccccaaggacatcctgaccttacgg
ctggaagtgctgatggagaccgagagccgactccacttcacgatcaaagaccctgccaac
cggcgctacgaggtgccctgggagaccccgcgcacgcgccgccgcgcaccgtcgtccctc
tacagcgtggagttctccgaggagccctttgggctggtcgtgcgccgcaagctggacggc
agggtgctgctgaacaccacggtggcccccctgttcttcgctgaccagttcctgcagctg
tccacgtccctgccgtcccagcacataactggcctcgccgagcacctgggccccctgatg
ctcagcaccaactggaccaagattaccctctggaaccgggacatcgcccccgtgcctgac
gtaaacctgtacgggtcccaccccttctacctggcgctggaggacggcgggctggctcac
ggggtcttcctcctgaacagcaatgccatggacgtggtcctgcagccgagcccagccctc
agctggaggtcaacaggcgggatcctggacgtgtacgtcttcctgggcccggaccccaag
agcgtggtgcggcagtacctggacattgtgggctacccgttcatgccgccctactggggc
ctgggcttccacctgtgccgctggggctactcgtccaccgccatcacccgccaggtggtg
gagaacatgaccagggcccacttccccctggacgtccagtggaatgacctggactacatg
gacgccaagagggacttcacttttaacaaggacggctttggggacttcccggccatggtg
caggagctccaccagagcggccggcggtatgtgatgatcgtggaccccgccatcagcagt
gccgggccccccgggagctaccgaccctacgacgagggtctgcggagacgggttttcatc
accaacgagaccgggcagccactgattgggaaggtgtggccgggacccactgccttcccc
gacttcaccaaccccgagacccttgactggtggcaggacatggtggccgagttccacgcc
caagtgcccttcgacggcatgtggattgacatgaacgagccatccaacttcgtgaagggc
tccgtggacggctgtcccgccaatgacctggagaacccgccctatgtgccgggtgtggct
ggcgggaccctccgtgcagctaccatctgcgcctccagccgccagctcctctctacccac
tacaacctgcacaacctgtacggcctgacggaggccgtggcctcccacagggccctggtg
aagactcgggggacacgccccttcgtgatctcccgctccaccttcgccggccacggccga
tatgccggccactggacaggggacgtgcagagcagctgggagcagctctcctcctccgtg
ccagaaatcctgctcttcaacctgctgggggtgcccctggtcggggccgacgtctgcggc
ttcctgggcgacacctcggaggagctgtgcgtgcgctggacgcagctgggggccttctac
cccttcatgcggaaccacaacgacctgcacagccagccacaggagccgtatcggttcagc
gaggcggcccagcaggccatgaggaaggccttggccctgcgctacgcgctgctgccgcat
nncttcctcggggcccacgccaggggcgagaccgtggcccggcccctcttcctagagttt
cccgaggaccccagcacctggaccgtggaccgccagctcctgtggggagaggctctgctc
gttaccccagtgctcgaggccgggaaggtggaggtgaccggctacttcccctccggcacg
tggtacgacctgcagacggtgccagtagaggcccttggcagcctcccgcctccacctcca
gcacccctcaagtctgccgtccacagcaagggtcagtgggtgacactgtcagccccactg
gacaccatcaacctccacctgcgggctgggcacatcatccccctgcagggccccggcctc
tccaccacggagtcccgtaagcagcccatggcccttgccgtggccctgactgggagcggg
gaggcccgaggggagctcttctgggacgacggggagagcctgggggcgctggagcgcggg
gcctacacgcagctcgtcttcctggccaggaacaacaccatcgtcaacgagctggtgcac
gtgaccggtgagggggctggcctgcagctgaggaaggtgactgtcctgggggtggccacg
gccccccagcaggttgtgtccaatggcgttcctgtctccaacttcacctacaaccccgac
agccagaccctggccattcctgtctcgctggcactgggagagcagttcctcatcagctgg
tcttaa

DBGET integrated database retrieval system