KEGG   Pteropus alecto (black flying fox): 102885962
Entry
102885962         CDS       T02993                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04114  Oocyte meiosis
pale04140  Autophagy - animal
pale04144  Endocytosis
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04510  Focal adhesion
pale04520  Adherens junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04730  Long-term depression
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05205  Proteoglycans in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885962 (IGF1R)
   04014 Ras signaling pathway
    102885962 (IGF1R)
   04015 Rap1 signaling pathway
    102885962 (IGF1R)
   04066 HIF-1 signaling pathway
    102885962 (IGF1R)
   04068 FoxO signaling pathway
    102885962 (IGF1R)
   04151 PI3K-Akt signaling pathway
    102885962 (IGF1R)
   04152 AMPK signaling pathway
    102885962 (IGF1R)
   04150 mTOR signaling pathway
    102885962 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102885962 (IGF1R)
   04140 Autophagy - animal
    102885962 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102885962 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885962 (IGF1R)
   04520 Adherens junction
    102885962 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    102885962 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102885962 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    102885962 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    102885962 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    102885962 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    102885962 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885962 (IGF1R)
   05202 Transcriptional misregulation in cancer
    102885962 (IGF1R)
   05205 Proteoglycans in cancer
    102885962 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102885962 (IGF1R)
   05214 Glioma
    102885962 (IGF1R)
   05218 Melanoma
    102885962 (IGF1R)
   05215 Prostate cancer
    102885962 (IGF1R)
   05224 Breast cancer
    102885962 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885962 (IGF1R)
   01522 Endocrine resistance
    102885962 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885962 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pale04090]
    102885962 (IGF1R)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102885962 (IGF1R)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102885962 (IGF1R)
CD molecules [BR:pale04090]
 Proteins
  102885962 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Furin-like Pkinase fn3 Insulin_TMD Kinase-like
Other DBs
NCBI-GeneID: 102885962
NCBI-ProteinID: XP_006924199
LinkDB
Position
Unknown
AA seq 1372 aa
MKSGSGGGSPTSLWGLLFFCVALSLWPATGEICGPGIDIRNDYQQLRRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGAMEGKPLCEKTSINNEYNYRCWTTNQCQKTCPSACGKRACTEDHECCHPECLGGCS
APDDDAACVACRHYYFAGVCVPSCPPSTYRFEGWRCVDRDFCANIPNAESSDTEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDALHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPSNKDIEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTFDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVAQVANTTMSSRSRNSTADAYNVTDLEELETEYPFYESR
VDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWE
SRPENSIFLKWPEPENPNGLILMYEIKYGSQLEDQRECVSRQEYRKYGGAKLNRLNPGNY
TARIQATSLSGNGSWTDPVFFYVQAKTTYENFMHLIIALPIAILLIVGGLVIMLYVFHRK
RNSNRLGNGVLYASVNPEYFSAADVYVPDEWEVARDKITMSRELGQGSFGMVYEGVAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFVLSPPVCHSSQVRLLGVVSQGQPT
LVIMELMTRGDLKSYLRSMRPEIENNLVLVPPSLSKMIQMAGEIADGMAYLNANKFVHRD
LAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDV
WSFGVVLWEIATLAEQPYQGFSNEQVLRFVMEGGLLDKPDNCPDIMFELMRMCWQYNPKM
RPSFLEIIGSIKDEMEPGFQEVSFYYSDENKPPDMEELDLEPENMESIPLDPSASSLSLP
LPDRHSGHRAENGPGPGMLVLRASFDDRQPYAHMNGGRKNERPLPLPQSSTC
NT seq 4119 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctgc
gtcgcgctctcgctgtggccggcgaccggagaaatctgcgggcccggcatcgacatccgc
aacgactaccagcagctgaggcgcctggagaactgcacggtgatcgagggttacctgcac
atcctgctcatctccaaggccgaggactatcggagctaccgcttccccaagctcacggtc
atcaccgagtacctgctgctgttccgcgtggccggcctcgagagcctcggcgacctcttc
ccgaacctcacggtcatccgcggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggacatcgggctttacaacctgcggaacattacccggggggcc
atcaggatcgagaaaaacgccgacctctgctacctgtccacggtggactggtccctgatc
ctggacgccgtctccaacaactacatcgtggggaacaagcccccaaaggagtgtggggac
ctgtgtccaggggcgatggaggggaagccgctgtgtgagaagaccagcatcaacaatgaa
tacaactaccgttgctggacgacaaaccagtgccagaaaacgtgcccgagcgcgtgcggg
aagcgggcgtgcacggaggaccacgagtgctgccaccccgagtgcctgggcggctgcagc
gcgcccgacgacgacgcggcctgcgtggcctgtcgccactactacttcgccggcgtgtgc
gtgcccagctgcccgcccagcacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccaacgccgagagcagcgacaccgagggcttcgtcatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgcgaaggaccttgccccaaagtctgcgaggaagaaaagaaaacgaagacc
attgattcggttacttctgctcagatgctccaaggatgcaccatattcaagggcaatttg
ctcattaatattcgacgaggcaataacattgcctcggagctggagaacttcatggggctt
attgaggtggtgacgggctacgtgaagatccgtcattcccacgccttggtgtccttgtcc
ttcctgaaaaaccttcgccagatcttaggagaggagcagctggaggggaattactccttc
tacgtcctcgacaaccagaacctgcagcagctgtgggactgggaccaccggaacctcacc
atcaaggccgggaaaatgtacttcgccttcaaccccaaactctgtgtctccgaaatttac
cgcatggaggaggtgacggggaccaaagggcgccagagcaaaggggacataaacaccagg
aacaacggagagagagcctcctgtgagagcgacgccctgcacttcacctctaccacgacg
tggaagaaccgcatcatcatcacgtggcaccggtaccggccgccagactacagggacctc
atcagcttcaccgtctactacaaggaagcaccctttaaaaacgtaacggaatatgacggg
caggacgcctgcggctccaacagctggaacatggtggacgtggacctcccttccaataag
gacatcgagcccggcatcctactgcacgggctgaagccctggacgcagtacgccgtgtac
gtcaaggccgtgaccctgaccatggtggagaatgaccacatccgcggagccaagagcgaa
atcttgtacatccgcaccaacgcctcagttccttccatccccctggacgtcctgtccgcg
tccaattcctcttcccagctgatcgtgaagtggaacccgccctctctgcccaacggcaac
ctgagctactacatcgtgaggtggcagcgccagcctcaggacagctacctgtaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgatggcaccttcgacatc
gaggaggtgacagagaaccccaagacggaggtgtgcggtggggagaaggggccttgctgc
gcgtgccccaaaaccgaagccgagaagcaggcggagaaggaggaggccgagtaccgcaaa
gtcttcgagaacttcctgcacaattccatcttcgtgcccagacccgagcggaagcggaga
gatgtcgcacaggtggccaacaccaccatgtccagccgaagcaggaacagcacggcggac
gcctacaacgtcacagacctggaagagctggagacggaatatcctttctacgagagcaga
gtggacaacaaggagagaaccgtcatctccaacctgcggcccttcactctgtaccgcatc
gacatccacagctgcaaccacgaggcggagaagctgggctgcagcgcctccaacttcgtt
tttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtgacctgggag
tcgcggccggaaaactccatctttttaaagtggccggaacctgagaatcccaatggatta
attctaatgtatgaaataaaatacggatcacaactcgaggaccagcgggagtgcgtgtcc
aggcaggagtaccgaaagtacggaggcgccaagctgaaccggctcaacccgggcaactac
acggcccgcatccaggccacctctctgtccggaaatgggtcgtggacggaccctgtgttc
ttctacgtccaggccaaaacgacctatgaaaatttcatgcacctgatcatcgccctgccc
atcgccatcctgctcatagtgggggggctggtgataatgctgtatgtcttccaccggaaa
agaaacagcaacaggctggggaatggagtgctgtacgcgtccgtgaaccccgaatacttc
agcgcggctgacgtgtacgtgcccgacgagtgggaggtggcccgcgacaagatcaccatg
agccgggagctgggccagggctccttcgggatggtgtatgagggcgtggccaagggcgtg
gtcaaggacgagcccgaaaccagggtggccattaaaaccgtgaacgaggccgcgagcatg
cgcgagaggattgaatttctcaacgaggcttcggtgatgaaggagtttgttctgagtcct
cctgtctgccattcctcccaggtgcggctgctgggcgtggtgtcccagggccagccaacg
ctggtcatcatggaactgatgacacgaggcgatctcaagagttacctcaggtccatgagg
ccggagatcgagaataatctggtcctcgtgcctccaagcctgagcaagatgatccagatg
gcgggagagatcgcggacggcatggcgtacctgaacgccaacaagttcgtgcacagagat
ctggccgcccgcaactgcatggtggccgaggatttcaccgtcaaaatcggagatttcggt
atgaccagagacatctacgagacagactattaccggaagggagggaaaggcctgctgccc
gtgcgctggatgtcccctgagtccctgaaggacggcgtcttcaccactcattctgacgtc
tggtccttcggcgtcgtcctctgggagatcgccacgctggccgagcagccgtaccagggc
ttctccaacgagcaggtgctgcgcttcgtcatggagggcggcctgctggacaagccggac
aactgccccgacataatgttcgagctgatgcgcatgtgctggcagtacaaccccaagatg
cggccgtcgttcctggagatcatcggcagcatcaaggacgagatggagcccggcttccag
gaggtgtccttctactacagcgacgagaacaagccgcccgacatggaggagctggacctg
gagccggagaacatggagagcatcccgctggacccgtcggcctcgtcgctgtccctgccg
ctgcccgacagacactcgggacacagggccgagaacggcccgggcccgggcatgctggtc
ctccgggccagcttcgacgacaggcagccttacgcgcacatgaacgggggacgcaagaac
gagaggccgctgcctctgccccagtcgtccacctgctga

DBGET integrated database retrieval system