KEGG   Pteropus alecto (black flying fox): 102885990Help
Entry
102885990         CDS       T02993                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04360  Axon guidance
pale04510  Focal adhesion
pale04520  Adherens junction
pale05100  Bacterial invasion of epithelial cells
pale05144  Malaria
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05211  Renal cell carcinoma
pale05218  Melanoma
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102885990 (MET)
   04015 Rap1 signaling pathway
    102885990 (MET)
   04010 MAPK signaling pathway
    102885990 (MET)
   04151 PI3K-Akt signaling pathway
    102885990 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102885990 (MET)
   04520 Adherens junction
    102885990 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102885990 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885990 (MET)
   05202 Transcriptional misregulation in cancer
    102885990 (MET)
   05206 MicroRNAs in cancer
    102885990 (MET)
   05205 Proteoglycans in cancer
    102885990 (MET)
   05230 Central carbon metabolism in cancer
    102885990 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102885990 (MET)
   05226 Gastric cancer
    102885990 (MET)
   05218 Melanoma
    102885990 (MET)
   05211 Renal cell carcinoma
    102885990 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102885990 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    102885990 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885990 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102885990 (MET)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102885990 (MET)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  MET family
   102885990 (MET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Linker_histone Ninjurin
Motif
Other DBs
NCBI-GeneID: 102885990
NCBI-ProteinID: XP_006910646
LinkDB All DBs
Position
Unknown
AA seq 1382 aa AA seqDB search
MKAHAVFAPGILVLLFTLVQKSDGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYVGAINYIYVLNDKDLQKVAEYKTGPVLEHPDCSPCQDCSHKANVSGGVWKDNINMVL
LVDTYYDDQLISCGSVHRGTCQRHVLPPYNTADIQFEVHCMYSPQADEDPGQCPDCVVSA
LGTKVLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVYAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVGKPGAHLAKQIGANLDDDILYGVFAQSKPDSAEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVHSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
HLDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVRMEECPNGSWTQDICHPTIYEVFPTSAPLEGGTVLTICGWDFGFRRNNKFDLK
KTRILLGNESCTLTLSESTTNTLKCTVGPAMNEHFNMSIIISNGRGTAQYSIFSYVDPII
TSISPSYGPKTGGTLLTLTGKYLNSGNSRHISVGGKTCTLKSVSDSILECYTPAQTTPTE
FPIKLKIDLANRETNSFSYREDPIVYEIYPTKSFISGGSTITGVGKNLNSVSVLRMVINV
REAERNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFEKPVMISIGNENILEIKGNDIDPEAVKGEVLKVGNKSCENIYSHSEAVLCTVPND
LLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKRRK
QIKDLGSELVRYDARVYTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNR
TCRQVQYPLMDLSPILTGGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDSDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFAELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEG
DT
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccatgctgtgtttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcgatggggaatgcaaagaggcactagtaaagtctgagatgaatgtgaacatgaag
tatcagctccccaactttaccgcggaaacacccatccagaatgtcgttttacacaagcat
cacatttacgttggtgccattaactacatttacgttttaaatgacaaagaccttcagaag
gttgctgagtataagactgggcccgtgctggaacacccagattgctcaccatgtcaggac
tgcagccacaaagccaatgtttcaggaggcgtttggaaagataacatcaacatggttctt
cttgttgatacatactatgatgaccaacttattagctgcggcagcgtccacagagggacc
tgccagcgacacgtccttccaccctataatactgctgacatacagttcgaggtacattgc
atgtactccccacaagcagacgaagaccccggccagtgtcctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgctgtctgaaaaggatcggttcatcaacttctttgtgggcaat
accataaattcttcttacctgccagatcattcattgcattccatatcagtgagaagacta
aaggaaacacaagatggttttaagtttttgacagaccagtcctatattgatgttttacct
gagttccgagattcttaccccattaagtatgtctacgcctttgaaagcaaccattttatt
tactttttgacggtccaacgggaaactctcgatgctcagacatttcacacaagaataatc
aggttctgttccgtagactctggtttgcattcctacatggaaatgccactggagtgtatt
ctcacagaaaagagaagaaagagatccacaagggaagaagtgtttaatattctccaagcc
gcatatgtcggtaagcctggggcccatctcgctaagcaaataggtgccaacctggatgat
gacattctctacggagtgtttgctcagagcaagccagattctgccgaaccgatgaatcgc
tctgccgtctgtgcgttccccatcaagtatgtcaatgaattcttcaacaagattgtcaac
aaaaacaacgtgaggtgtctccagcatttttacggacccaaccatgaacactgctttaat
aggacacttttgagaaattcatcgggctgtgaagtgcacagtgacgaatatcgaacagag
tttaccacagctttgcagcgcgttgacttattcatgggccagttcaaccaagtcctctta
acgtctatttccaccttcattaaaggagacctcaccatcgctaaccttgggacatcagag
ggtcgcttcatgcaggttgtggtttctcgatcaggatcatcaacccctcatgtgaatttt
cacctggattcccaccctgtgtctcctgaagtgattgtagagcacccattaaaccaaaat
ggctacacactggttgtcactgggaagaagatcaccaagattccactgaatggcttgggc
tgtgagcatttccagtcctgcagtcagtgtctctctgctcctccctttgtgcagtgtggc
tggtgccacgacaaatgtgtgcgaatggaggaatgccccaatggaagttggactcaggac
atctgtcatcctacaatctacgaggttttcccaactagtgcccctctggaaggagggaca
gtgctgaccatatgtggctgggactttggattcaggaggaataataaatttgatttaaag
aaaaccagaattctccttggaaatgagagctgcaccttgaccttaagtgagagtacaaca
aatacattgaaatgcacagttggtcctgcaatgaatgagcatttcaatatgtccataatt
atttcaaatggtcgagggacagcgcaatatagtatattttcttatgtggatcctataata
acaagtatttctccaagttacggtcctaagactggtggcactttacttactttaactgga
aagtacctaaacagtgggaattctagacacatttcagttggcggaaaaacctgtactttg
aaaagtgtgtcagatagtattctcgaatgttataccccagcccaaaccactccaactgag
tttcctattaaactgaaaattgacttagccaaccgagagactaacagcttcagttaccgg
gaagaccccattgtctatgaaatttatccaaccaaatcttttattagtggtgggagcaca
ataacaggtgttggaaaaaacctgaattcagttagtgtcctgaggatggtgataaatgtg
cgtgaagcagaaaggaactttacagtggcgtgtcaacatcgctctaattcagagataatc
tgctgtacaactccttcactacaacagctgaatctgcaactccctctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaatactttgatctcatttatgtgcataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaacatactggaa
attaagggaaatgacattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagaatatatactcacattctgaagctgttttatgtacagtccccaatgac
ctgctgaaattgaacagcgagctaaatatagagtggaagcaagcagtttcttcaactgtc
cttggaaaagttatagttcaaccagatcagaatttcacaggattgattgttggtgttgtc
tcaatatcaataatactcttattattacttgggcttttcctgtggctgaaaaggagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtatacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaacaga
acatgcagacaagtgcagtatcctctgatggacctatcccccatcctaactggtggggac
tctgatatatccagcccattactgcaaaatactgtccacattgacctcagcgctctaaat
ccagagctggttcaggcagtccagcacgtagtgattgggcctagtagcctgattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgcgtatatcatgggactttgttggac
agtgacgacaagaaaattcactgtgctgtgaaatcattgaatagaatcactgacatagga
gaagtttctcaatttctgaccgaaggaatcatcatgaaagattttagtcatcccaatgtc
ctctcactcttgggaatctgccttcgaagtgaggggtccccattggtggtcctaccttat
atgaaacatggagatcttcgaaatttcattagaaatgagactcataacccaactgtcaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaag
gttgctgattttggtcttgccagagacatgtatgataaagaatactacagtgtacacaac
aaaacaggtgcaaaactgccagtgaagtggatggccttagagagtctgcaaactcagaag
tttaccaccaagtcagatgtgtggtcctttggcgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgacgtcaacacctttgatataacagtttacttgttgcaaggc
agaaggctcttacaaccagaatactgcccagatcccttgtatgaagtgatgctaaaatgc
tggcaccctaaagctgaactgcgcccatcctttgctgaactggtctccaggatatcagcc
atattctctactttcatcggggagcactatgtccacgtaaacgctacgtatgtgaatgtc
aaatgtgtcgctccatacccttcgctgttgtcatcacaagataacgttgatggtgaggga
gacacatga

DBGET integrated database retrieval system