KEGG   Pteropus alecto (black flying fox): 102886089Help
Entry
102886089         CDS       T02993                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00030  Pentose phosphate pathway
pale00051  Fructose and mannose metabolism
pale00052  Galactose metabolism
pale01100  Metabolic pathways
pale01200  Carbon metabolism
pale01230  Biosynthesis of amino acids
pale03018  RNA degradation
pale04152  AMPK signaling pathway
pale05230  Central carbon metabolism in cancer
Module
pale_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102886089 (PFKP)
   00030 Pentose phosphate pathway
    102886089 (PFKP)
   00051 Fructose and mannose metabolism
    102886089 (PFKP)
   00052 Galactose metabolism
    102886089 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102886089 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102886089 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102886089 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102886089 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102886089 (PFKP)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102886089 (PFKP)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102886089 (PFKP)
Messenger RNA biogenesis [BR:pale03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102886089 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102886089
NCBI-ProteinID: XP_006917259
UniProt: L5K9S3
LinkDB All DBs
Position
Unknown
AA seq 791 aa AA seqDB search
MDRDNVPTTPKASFRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKAFRTREGRLSAACNLVQCGI
TNLCVIGGDGSLTGANIFREEWSGLLEELARNGKIDKGEVEKYAHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFI
PESPPEEGWQETMCVKLSENRARKKRLNIIIVAEGAIDNQNKPITSEQIKELVVKQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQTTQDVQKAMDERRFKDAVQLRGRSFEDNLNIYKRLASKMPDSQIPKSSHNVGIINVG
APAAGMNAAVRSAVRVGISNGHKMFAIYDGFEGFARGQIKEIGWSDVGGWTGQGGSILGT
KRTLPGKHLEQIAAQMRKHSLNALLIVGGFEAYLGLLELSAAREQHEELCVPVVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGALAAG
ADAAYIFEEPFDIRDLQSNVEHLTQKMKTSIQRGLVLRNESCNENYTTDFIYQLYSEEGR
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISTKLKEARGAGKRFVTDESICV
LGICKRNFLFQPVAELKKETDFEHRIPREQWWLKLRPLMKILAKYKASFEVSDLGQLEHV
PSHGYGEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagataatgtccccacgacccccaaggcctccttccgaaagttcctggagcac
ctctctggggccggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggcatg
aacgccgcggtgcgcgccgtcgtgcgcatgggcatctacgtgggcgccaaggtgtacttc
atctacgagggataccaaggcatggtggacggtggcagcaacatcgtcgaagcagactgg
gagagcgtctccagcatcctgcaagtgggaggcaccatcatcggcagcgcccgctgcaag
gccttccgcacccgcgagggccgcctgagcgccgcctgcaacctggtccagtgcggcatc
accaatctatgtgtgatcggcggggacgggagcctcaccggggccaacatcttccgggag
gagtggagcgggctgctggaggagctggcccgcaatggcaagattgacaagggggaggtg
gagaagtacgcacacctcaacgtggtggggatggtgggctccatcgacaacgacttctgc
gggaccgacatgaccatcggcaccgactcggctttgcaccgaataatcgaagttgtggac
gccatcatgacgaccgcccagagccaccagaggaccttcgttctcgaggttatggggaga
cactgtgggtacctcgcgctggtgagcgccttggcctgtggggcagactgggtgttcatt
ccggagtcgcccccggaagagggctggcaggagaccatgtgcgtcaagctgtcggagaac
cgagcccggaaaaaaaggctgaacatcatcatcgtggctgaaggagcgatcgataaccaa
aataagcctatcacctcggagcagatcaaggagctggtggtgaagcagctgggctatgac
acacgtgtgaccatactcggccacgtgcagagaggtgggacaccctcggccttcgacagg
attttggccagccgcatgggagtggaggctgtcgtcgccctcctgcaggccaccccagag
accccggcgtgcgtggtgtcactgagcgggaaccaggccgtgcgactacccctgatggag
tgcgtgcagacgacccaggacgtgcagaaggcgatggacgagaggaggttcaaggacgcc
gtgcagctccgaggaaggagcttcgaggacaacctcaacatctacaagcggctcgccagc
aagatgccggactcccagatccccaagagcagccacaacgtgggcatcatcaacgtgggc
gcgccggccgccgggatgaacgcggccgtgcgctcggcggtgcgcgtcggcatctccaat
gggcacaagatgttcgccatctacgatggcttcgaaggcttcgccagaggccagataaaa
gaaatcggctggtcagatgtcggaggctggaccggacaaggcggttctattcttgggaca
aaacggacgctccctgggaagcacctggagcagatcgccgcccagatgcgcaaacacagc
ctcaacgcgttgctgatcgtcggtggcttcgaggcctatctgggtctgctggaactgtca
gccgcccgggagcagcacgaggaactgtgcgtccctgtggttatggtccccgccaccgtc
tccaacaatgtgccggggtccgatttcagcattggcgccgacaccgccctcaacaccatc
actgacacgtgcgaccgcatcaagcagtcagccagtgggaccaagcgccgcgtgttcatc
atcgagaccatgggcggcttctgtggctacctggccaacatgggggccctggcggccggc
gccgacgctgcctacattttcgaggaacccttcgacatccgggacctacagagcaacgtg
gagcatctgacgcagaaaatgaagaccagcatccagagggggctcgtgctcaggaacgag
agctgcaacgagaactacaccaccgacttcatctaccagctgtactcggaggagggcagg
ggcgtcttcgactgcaggaagaacgtgctgggccacatgcagcagggcggagcaccgtcc
ccatttgacaggaactttgggaccaagatctcggcccgggccatgcagtggatcagcacc
aagctgaaggaggcacgaggcgcagggaaaagattcgtgaccgatgagtccatctgtgtg
ctggggatttgcaagagaaactttctgttccagcccgtggcggagctgaagaaggagacg
gactttgagcacagaatcccccgcgagcagtggtggctgaagctgcggcccctcatgaag
atcctggccaagtacaaggccagcttcgaggtgtcggacttgggccagctggagcacgtg
cccagccatggctacggcgagcctgcggctatctag

DBGET integrated database retrieval system