KEGG   Pteropus alecto (black flying fox): 102886232
Entry
102886232         CDS       T02993                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
pale01522  Endocrine resistance
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04072  Phospholipase D signaling pathway
pale04114  Oocyte meiosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04727  GABAergic synapse
pale04740  Olfactory transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05032  Morphine addiction
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102886232 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102886232 (ADCY3)
   04371 Apelin signaling pathway
    102886232 (ADCY3)
   04020 Calcium signaling pathway
    102886232 (ADCY3)
   04072 Phospholipase D signaling pathway
    102886232 (ADCY3)
   04024 cAMP signaling pathway
    102886232 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102886232 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102886232 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102886232 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102886232 (ADCY3)
   04062 Chemokine signaling pathway
    102886232 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102886232 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102886232 (ADCY3)
   04912 GnRH signaling pathway
    102886232 (ADCY3)
   04913 Ovarian steroidogenesis
    102886232 (ADCY3)
   04915 Estrogen signaling pathway
    102886232 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102886232 (ADCY3)
   04921 Oxytocin signaling pathway
    102886232 (ADCY3)
   04926 Relaxin signaling pathway
    102886232 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102886232 (ADCY3)
   04918 Thyroid hormone synthesis
    102886232 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102886232 (ADCY3)
   04916 Melanogenesis
    102886232 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102886232 (ADCY3)
   04927 Cortisol synthesis and secretion
    102886232 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102886232 (ADCY3)
   04270 Vascular smooth muscle contraction
    102886232 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102886232 (ADCY3)
   04971 Gastric acid secretion
    102886232 (ADCY3)
   04972 Pancreatic secretion
    102886232 (ADCY3)
   04976 Bile secretion
    102886232 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102886232 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102886232 (ADCY3)
   04727 GABAergic synapse
    102886232 (ADCY3)
   04725 Cholinergic synapse
    102886232 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102886232 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102886232 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102886232 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102886232 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102886232 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102886232 (ADCY3)
   04714 Thermogenesis
    102886232 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886232 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102886232 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102886232 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102886232 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886232 (ADCY3)
   05163 Human cytomegalovirus infection
    102886232 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102886232 (ADCY3)
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102886232 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 102886232
NCBI-ProteinID: XP_006910341
LinkDB
Position
Unknown
AA seq 1145 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPERGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSRDQLAPLVVAGIWLLLDII
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVVISVVSCIVHTLVLGVTVAQQQQDGLKGMQLLREILASVSLYLCAIIVG
ITSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAVQNGLNGSALPNGAPPSSQPSSPALIETKEPNGSVHA
SGSTSEEPEEQGAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMEPEMETRYSVEKEKQSGAAFSCSCVVLLCAALGEMLVDPWLMTN
YVTFVVGEVLLLILTICSLAAIFPQAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNGTAGMEMEDGCTENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLITGAVAVVNIYAWCPIFDEYDRRRFQEHNFPVVALEKMQILSTAGLNGTDRLPLLPSK
YSMTAMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEDTQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccccgagtactcggcggagtactcggcggagtac
tccgtcagcctgccctctgaccctgagcgcggggtgggccggacccatgaaatctctgtg
cggaactcggggtcctgcctctgcctgcctcgctttatgcggctgactttcgtgcccgag
tccttggagaacctgtaccagacctatttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgctgtggtcttc
tcccgcgaccagctggctcccctcgtggtggctgggatctggctgctgttggatatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccggaaagtggtgccc
tatctcctgtggctgctgataacagcccagatcttctcctacttgggcctgaactttgcc
cgcgcccatgcggccagcgacacagtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgttgtcatctctgtggtctcctgtattgtg
cacaccctcgtcttgggggtcaccgtggcccagcagcagcaggatggactgaaggggatg
cagttgctgagagagatcctggccagtgtctccctgtacctttgcgccatcatcgtgggc
atcacgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggccgacgagatgctcaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
cttttcgcggacatcgtgggcttcacccagctgtcctctgcctgcagcgcacaggagctc
gtgaagctgctcaacgagctctttgcccgttttgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgttactattgcatctgtggcctgcctgactaccga
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgagagaagacgaagaccggggtggacatgcgtgtgggggtgcacacaggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtttggtccactgatgtgact
gtggccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcacagagcacc
ttggactgcctgaagggggagttcgacgtggagccgggcgacgggggcagccgctgcgac
tacctggatgagaagggcatcgaaacctacctcatcatcgcatccaagccagaggtgaag
aagacggccgtccaaaatggcctcaatggctcggccctgcccaatggagccccgccttcc
tcgcagcccagctcccccgccctcatcgagaccaaggagcccaacgggagtgtccacgcc
agcgggtccacgtcggaggagcccgaggagcaaggggcccaggctgacaacccctccttc
cccaaccctcgccggaggctgcgcctccaggacctggccgacagagtggtagacgcctcc
gaggacgagcatgagctcaaccagctgctcaacgaggccctgctcgagcgggagtccgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggagcccgagatg
gagacgcgctactcagtggagaaggagaagcagagcggagctgccttcagctgctcctgc
gtcgtcctgctctgtgcggccctgggcgagatgctcgtcgacccctggctaatgacaaac
tatgtgacctttgtggttggggaggttctgcttctgatcctgacgatctgctcgctggct
gccatctttccccaggcctttcctaagaagctcgtggccttctcaacctggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggcaaat
gtcgtggacatgcttagctgcctccagtactacacgggacccagcaacggcaccgcaggg
atggagatggaggatggctgcacggagaaccccaagtattacaactatgtcgccgtgctg
tcactcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcatcactggcgccgtagccgtcgtcaacatctatgcctggtgccccatcttcgat
gaatatgaccgcagacgtttccaggaacacaactttcctgtggttgccttggagaagatg
cagatactctccaccgctgggctcaatggcactgacaggctgcccctgctgccctccaag
tactcgatgacagcgatgatcttcgtcatgatgctgagcttttactacttctcccgccac
gtggaaaaactggctcggacactgttcttatggaagattgaggtccatgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaggccttggtcaccaacatgttgcccgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggaactgtacagccagtcttat
gatgagattggagtcatgtttgcctccctgcccaacttcgctgacttctacacagaggag
agcatcaataatggtggcattgagtgtctgcgctttctcaacgagatcatctcagatttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagt
acctatatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggctgatctggctgacttc
gcactagccatgaaggatacgcttaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgttgccagcaggatggagtccacgggggtc
atgggcaacattcaggtggtagaagacacacaggccatcctccgagagtacggcttccgc
ttcgtgaggcgagggcccatctttgtgaaagggaaaggggagctgctaacctttttcttg
aaaggccgtgacaagccagccaccttccctaacggctcctctgtcacactgccccaccag
gtggtagacaactcctga

DBGET integrated database retrieval system