KEGG   Pteropus alecto (black flying fox): 102886521
Entry
102886521         CDS       T02993                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04310  Wnt signaling pathway
pale04350  TGF-beta signaling pathway
pale04371  Apelin signaling pathway
pale04390  Hippo signaling pathway
pale04520  Adherens junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04659  Th17 cell differentiation
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102886521 (SMAD4)
   04350 TGF-beta signaling pathway
    102886521 (SMAD4)
   04390 Hippo signaling pathway
    102886521 (SMAD4)
   04371 Apelin signaling pathway
    102886521 (SMAD4)
   04068 FoxO signaling pathway
    102886521 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102886521 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102886521 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102886521 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102886521 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886521 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102886521 (SMAD4)
   05212 Pancreatic cancer
    102886521 (SMAD4)
   05225 Hepatocellular carcinoma
    102886521 (SMAD4)
   05226 Gastric cancer
    102886521 (SMAD4)
   05220 Chronic myeloid leukemia
    102886521 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102886521 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886521 (SMAD4)
   05161 Hepatitis B
    102886521 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102886521
NCBI-ProteinID: XP_006919954
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtgaagaaactgaaggagaaaaaggatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggttgccggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgacagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgacttcgagggacagccatcgttatccaccgaagggcattcaattcaa
accatccaacatccaccaagtaatcgtgcatcaacagagacatacagcaccccagctctc
ttagctccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttat
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttctaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggggaaggtgatgtttgggttagg
tgccttagcgaccatgcagtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgacagtgtcatcggcagatgcagcagcaggcggccactgcacaagctgcagcagctgcc
caggcagcagccgtggctggaaacatccctggcccaggatcagtaggtggaatagctcca
gctatcagtttgtcagctgctgctggaatcggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaagggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggattgagattcacttacaccgggctctccagctcctagatgaagttctt
cacaccatgcctattgcggacccacaacctttagactga

DBGET integrated database retrieval system