KEGG   Pteropus alecto (black flying fox): 102886545
Entry
102886545         CDS       T02993                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05200  Pathways in cancer
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886545 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    102886545 (RARB)
   05222 Small cell lung cancer
    102886545 (RARB)
   05223 Non-small cell lung cancer
    102886545 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102886545 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102886545 (RARB)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102886545 (RARB)
Nuclear receptors [BR:pale03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   102886545 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102886545
NCBI-ProteinID: XP_006905765
UniProt: L5L3F0
LinkDB
Position
Unknown
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECMESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcatactgctcaatcgattgaaacacagagcaccagc
tctgaggaactcgtcccgagccctccgtctccacttcctccccctcgcgtgtacaaaccc
tgcttcgtctgccaggacaaatcatcggggtaccactatggggtcagcgcctgtgagggc
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcacagagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagccttcgaaacaggaatgtatggaaagctatgaaatgacagctgagctggacgatctc
acagagaagatccgaaaggctcaccaggaaaccttcccctcgctctgccagctgggtaaa
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgcattattaagattgtggagtttgctaagcgtctgcca
ggcttcaccagcttgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgatccttagaatttgcaccagatataccccagaacaagacaccatgactttttca
gatggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccaacaaaa
gtagacaagctacaagaaccattgctggaagcactaaaaatttacatcagaaagagacga
cccagcaagccgcacatgtttccaaagatcttaatgaaaatcacagatctccgcagcatc
agcgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcgatgcca
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttaaccccaagttca
agtgggaatacagcagagcacagtcccagcatctcacccagctcagtggaaaacagcggt
gtcagtcagtcaccattggtgcaataa

DBGET integrated database retrieval system