KEGG   Pteropus alecto (black flying fox): 102886689Help
Entry
102886689         CDS       T02993                                 

Gene name
EZH2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2 isoform X7
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00310  Lysine degradation
pale05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102886689 (EZH2)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    102886689 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102886689 (EZH2)
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102886689 (EZH2)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102886689 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     102886689 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET EZH2_WD-Binding
Motif
Other DBs
NCBI-GeneID: 102886689
NCBI-ProteinID: XP_006920715
UniProt: L5K0U5
LinkDB All DBs
Position
Unknown
AA seq 746 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPDEREEKQKGLEENREDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLEAKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNSEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcggctgcggcagctcaagaggttcaggcgggctgacgaagtgaagagc
atgtttagttccaatcgtcagaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtacacatcctgacttctgtgagctcattgcgcgggacc
agggagtgttcagtgaccagtgacttggattttccaacacaagttatcccattaaagact
ctgaatgccgttgcttcagtacccataatgtattcttggtctcccctgcagcagaatttc
atggtggaagatgaaactgttttacataacattccttatatgggggatgaagttttagat
caagatgggacttttattgaagaactaataaaaaattatgatggaaaagtacatggggat
agagaatgtggatttataaatgatgaaatttttgtggagttggtgaatgctcttggtcag
tacaatgatgatgatgatgatgatgatggagatgatcctgatgaaagagaagaaaaacag
aaaggtctagaggagaaccgagaagataaagaaagccgcccacctcggaaatttccttct
gataaaattttcgaagccatttcctcaatgtttccagataagggcacagctgaagaactt
aaggaaaagtataaagaactcactgagcagcagctccccggtgcacttcctcctgaatgt
accccaaacatagacggaccaaacgctaaatctgttcagagggagcaaagcttgcattca
tttcatacgcttttctgtaggcgatgttttaaatatgactgcttcctacatcctttccat
gcaacacccaacacttacaagcggaagaacacggagaccgctctggacaacaagccctgt
ggaccgcagtgttaccagcacctggagggggcgaaggagttcgctgctgccctcaccgcc
gaacgcatcaagacgccaccaaagcgcccggggggccgccgaagggggaggctgcccaac
aacagcagcaggcccagcacccccaccatcaacgtgctggaggccaaggacacggacagt
gaccgggaggcggggaccgagactggtggtgagaacaacgataaagaagaggaggagaaa
aaagacgaaacctccagctcctctgaagccaactctcgctgtcagacaccaataaagatg
aagccaaacagcgagccccccgagaacgtggagtggagcggggccgaggcctccatgttc
cgtgtcctcatcggcacctactacgacaacttctgtgccattgccagattaattgggacc
aaaacgtgcagacaggtgtatgagtttcgggtcaaagaatccagcatcatagctccggct
cccgctgaggacgtcgatacccctccgaggaagaagaagaggaaacaccggttgtgggct
gcacactgcagaaagatacagctgaaaaaagacggctcctctaaccacgtttacaactac
caaccctgtgaccatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttcctggatgc
cgctgcaaagcacagtgcaacaccaagcagtgcccgtgctacctggccgtccgagagtgt
gaccctgacctctgtctcacctgtggagctgcggaccactgggacagcaagaatgtctcg
tgcaagaactgcagcatccagcggggctccaaaaagcatttactgctggcgccatctgat
gtggcaggctgggggattttcatcaaagatcccgtacagaagaatgaattcatctcggaa
tactgtggagagattatttctcaagatgaagcagacagaagagggaaagtgtatgacaag
tacatgtgcagctttctcttcaacttgaataatgattttgtggtggacgcaacccgcaag
ggtaacaaaattcgttttgcaaatcattcagtcaatcctaactgctatgcaaaagttatg
atggtcaacggcgatcacaggataggcatctttgcgaagagagccatccagactggtgaa
gagctgttttttgattacagatacagccaggctgatgccctgaagtacgtgggcatcgag
cgagagatggaaatcccttga

DBGET integrated database retrieval system