KEGG   Pteropus alecto (black flying fox): 102887326Help
Entry
102887326         CDS       T02993                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102887326 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102887326 (KMT5B)
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102887326 (KMT5B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102887326 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102887326
NCBI-ProteinID: XP_006911068
LinkDB All DBs
Position
Unknown
AA seq 881 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNEHQQNQSKLQHTGKDTVKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKSKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSSRKSSVGVKKTSKSRTLPRQSMSRIPA
SSNSTSSKLTHVNNSRVPKKPKKPAKPLLSKIKLRNHCKRLEQKSASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHKQSAGQGAPHGEGAPSTYTTRRS
ARTRMDSKETSDIKLEPNTLDGCKDSLAEARLDGGEQPAPTVQDEELAHDTAPIREAKCP
KSDNSIAKKKSRQGKLVRQLAKAEEPTPLHASPGGAGAGPDAMSHPAQGGHSGAEGSPGS
YGDWAPCPVDGSVVAAESFRARDGCRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRH
DSSSKTNDPENDGVNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRD
EEGRGSYPEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTGDSSSSGGEGEGEDYDDD
FEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggaggaatggaggcaag
ttgtctaatgaacatcagcagaatcaatcaaagttacagcacacgggaaaggacaccgtg
aaggctggcaaaaacgcagtcgagaggcggtcaagcagatgtaatggtaattcaggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggagctctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgagaagctcaaggcatttttccaaatctgacagttttcct
cacaacaaccctgtgagatttcggcctattaaaggaagacaagaagagctaaaggaagta
attgagcgttttaagaaagacgagcacttggagaaagctttcaaatgtttgacttcaggc
gaatgggcacggcactattttctcaacaagagcaagatgcaggagaagttattcaaggaa
catgtgttcatttacttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcatctgaacaaaatggagctaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gcccagctctggcttggtcctgctgcatttataaaccatgattgcagacctaactgcaag
tttgtgtcaactggtcgagatacagcgtgtgtgaaggctctaagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgcgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaacagtaaatacggactcagagagacagataaacgcttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagacaccactcaggaaaaaaacaacgcaacttctagccgcaaatcttcagttggt
gtgaaaaagaccagcaagagcagaacattaccgaggcagtctatgtccagaatcccagct
tcttccaactctacctcatctaagctaactcatgtaaataattccagggtaccaaagaaa
ccgaaaaagcctgcaaagcctttactctctaagataaaattaagaaatcattgcaaacgg
ctggagcagaagagtgcttcgagaaaactcgagatgggaaacttagtactgaaggagcct
aaagtcgttctgtataaaaatttgcccatcaaaaaagataaggagccggagggaccagca
caagccgcagtggccagtgggtgcttaaccagacacgcagcaagagagcacaaacagagc
gctgggcagggcgccccccacggggagggcgcccccagcacatacacaaccaggcggtct
gcgaggacacgaatggattcgaaggagacctctgacatcaagcttgaaccaaatacgttg
gacggctgtaaagacagcttggcggaagctcgcctggatggtggcgagcagccagctcct
acggtgcaggatgaagaactggcccacgacactgccccaatcagggaagcaaagtgtcct
aagagtgacaacagcattgcaaaaaagaagtcacgacaaggaaaacttgtgagacagttg
gccaaagcagaggagcccaccccgctgcacgcttccccaggaggggccggggccgggcca
gatgcgatgtcccaccccgcccagggcgggcacagcggcgcggagggctcgcccgggagc
tacggggactgggccccttgccccgttgacggctccgtcgtggcagcggagagcttcaga
gcaagagacggctgcagaactgcaaagagtaaaaagaagaggcggatcacaaggtacgac
gcgcagctgatcctggaaaacaactccgggatccccaaattgactcttcgcaggcgtcac
gacagcagcagcaagaccaacgacccagagaacgacggggtgaattcttcaaaaataagc
atcaagttaagtaaagaccacgaaaatgataataatctctatgtagcaaagctcaataat
ggatttaactcaggatcaggcagtagttccacaaaattgaaaatccagctaaagcgggac
gaggagggtaggggttcatacccagaggggcttcatgaaaacggggtgtgctgtagcgac
cctctgtccctgctggagtcccgcatggaagtcgacgactacagtcagtacgaggaagaa
agtacaggtgactcctcctcttccgggggggagggggagggggaggactatgatgatgac
tttgaagatgattttattcctcttcctccggccaagcgattgaggctaatagttgggaaa
gactctatagatattgacatttcttccaggagaagagaagatcagtctttgaggcttaac
gcgtaa

DBGET integrated database retrieval system