KEGG   Pteropus alecto (black flying fox): 102887379
Entry
102887379         CDS       T02993                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X3
  KO
K04726  BH3 interacting domain death agonist
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04071  Sphingolipid signaling pathway
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04650  Natural killer cell mediated cytotoxicity
pale04932  Non-alcoholic fatty liver disease
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05022  Pathways of neurodegeneration - multiple diseases
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102887379 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102887379 (BID)
   04215 Apoptosis - multiple species
    102887379 (BID)
   04217 Necroptosis
    102887379 (BID)
   04115 p53 signaling pathway
    102887379 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102887379 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887379 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102887379 (BID)
   05014 Amyotrophic lateral sclerosis
    102887379 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    102887379 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102887379 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102887379 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102887379 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102887379 (BID)
   05161 Hepatitis B
    102887379 (BID)
   05160 Hepatitis C
    102887379 (BID)
   05164 Influenza A
    102887379 (BID)
   05162 Measles
    102887379 (BID)
   05168 Herpes simplex virus 1 infection
    102887379 (BID)
   05163 Human cytomegalovirus infection
    102887379 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102887379 (BID)
   05169 Epstein-Barr virus infection
    102887379 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102887379 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C DUF2853
Other DBs
NCBI-GeneID: 102887379
NCBI-ProteinID: XP_006923973
LinkDB
Position
Unknown
AA seq 205 aa
MDPKISNGARLQHEHITDLLVFGFLQNCCNSNFHKELKALGHDLPVPAYPREDYDDELQT
DGNRCSHIVLEREETESENQEEIIQNIARQLAQIGDRMDSRIPPRVVNYLAMEFMNVDLS
EEDRKDCLSAALEEVMKTYPKDMEREKTMLMLTMLLAKKVADHTPSLLRGVFHTTVNFIN
QNLLTYVRNLLRNVRTSDVSSLASH
NT seq 618 nt   +upstreamnt  +downstreamnt
atggatcccaagatcagcaatggtgcacgccttcagcatgagcacatcacagacttgctg
gtgtttggcttcctccaaaactgctgcaactctaatttccacaaagagctgaaggcgttg
ggccatgacctgcctgtgccagcttacccgcgagaagattatgatgatgaactgcagacg
gatggtaaccggtgcagccatatcgtcttggaaagggaggagacagagtctgagaatcaa
gaggaaatcatccagaatatcgccaggcagctcgcccaaataggggacaggatggactcc
aggatccccccaagagtggtgaattacctggcaatggaatttatgaatgtggacctgtca
gaggaagacaggaaggattgcctctctgctgcgctggaggaggtcatgaagacttatcct
aaagacatggagagggagaagaccatgctgatgttgaccatgctgctggccaaaaaggtg
gccgatcacacaccatccttgctccgtggtgtctttcacacaacagtgaattttattaac
caaaacctgctcacctatgtgagaaacttattgagaaatgtaagaaccagtgatgtcagc
tccttggcatctcactaa

DBGET integrated database retrieval system