KEGG   Pteropus alecto (black flying fox): 102887578Help
Entry
102887578         CDS       T02993                                 

Gene name
DNMT3A
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00270  Cysteine and methionine metabolism
pale01100  Metabolic pathways
pale05206  MicroRNAs in cancer
Module
pale_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102887578 (DNMT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102887578 (DNMT3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102887578 (DNMT3A)
   03036 Chromosome and associated proteins [BR:pale03036]
    102887578 (DNMT3A)
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     102887578 (DNMT3A)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    102887578 (DNMT3A)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102887578 (DNMT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 102887578
NCBI-ProteinID: XP_015443675
LinkDB All DBs
Position
Unknown
AA seq 921 aa AA seqDB search
MPSSGPGDTSSSAPEREEDRKEGEEQEEARGKEERQEPSTTARKVGRPGRKRKHPLVESS
DTPKDPAVTSKSPSMAQDSGPAELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAE
TPPEASRAVENGCCTPKDGRGAPAEEGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQR
PMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQGSGESQKVEEAS
PPAVQQPTDPASPTVATTPEPVGADAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGF
SWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQP
MYRKAIYEVLQVASSRAGKLFPACHDSDESDTAKAVEVQNKQMIEWALGGFQPSGPKGLE
PPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEV
RQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGG
REVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRDDWPS
RLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIAS
EVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGL
YDSPADGFLFRLSEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISR
FLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVR
TITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGR
SWSVPVIRHLFAPLKEYFACV
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgccctccagcggccccggggacaccagcagctccgctccagagcgggaggaggaccgc
aaggagggagaggagcaggaggaggcacgtggcaaggaggagcggcaagagcccagcaca
actgcacggaaggtggggcggcctgggaggaagcgcaagcaccccctggtggaaagcagt
gacacgccgaaggaccctgcggtgacctccaagtccccatccatggcccaggactctggc
cccgcagagctgttacccaatggggacttggagaagcggagtgagcctcagccagaggag
gggagccctgctgggggtcagaagggcggggccccagcagagggagagggtgcagccgag
accccacctgaagcctccagagccgtggagaatggctgctgcacccccaaggatggccga
ggagcccccgcggaagagggcaaagaacagaaggagaccaacatcgagtccatgaaaatg
gagggctcccggggccggcttcggggtggcttgggctgggagtccagcctccgccagcgg
cccatgccgcggctcaccttccaggcgggggacccctactacatcagcaagcgcaagcgg
gacgagtggctggcacgctggaaaagggaggctgagaagaaagctaaggtgattgcagta
atgaatgctgtggaagaaaaccaggggtctggcgagtctcagaaagtggaggaggccagc
cctcctgcagtgcagcagcccaccgaccctgcatcccccactgtggccaccactcctgag
cccgtgggggccgatgctggggacaagaacgccaccaaagcagccgatgacgaaccggag
tacgaggacggccggggctttggcattggggagctggtgtgggggaaactgcggggcttc
tcctggtggccaggccgcattgtgtcttggtggatgaccggccggagtcgagcagctgaa
ggcacccgctgggtcatgtggttcggagacggcaagttctcagtggtgtgtgttgagaag
ctgatgccgctgagctccttttgcagtgctttccaccaggccacctacaataagcagccc
atgtaccgcaaagccatctacgaagtcctgcaggtggccagcagccgagcggggaagctg
ttcccagcgtgccatgacagcgacgagagcgacactgccaaggccgtggaggtgcagaac
aaacagatgatcgagtgggccctcgggggcttccagccctctggccccaagggcctggag
ccaccagaagaggagaagaatccctacaaagaagtttacacagacatgtgggttgaacct
gaggcagctgcctatgcaccccctccaccagccaaaaagccccgaaagagcacaactgag
aagcccaaggtcaaggagattattgatgaacgcacgagagagcggctggtgtacgaggtg
cggcagaagtgccggaacatcgaggacatttgcatctcttgtgggagcctcaatgtcacc
ctggaacaccctctcttcgttggaggaatgtgccaaaactgcaagaactgcttcctggag
tgtgcttaccagtacgatgacgacggctatcagtcctactgcaccatctgctgtgggggc
cgcgaggtgctcatgtgcgggaacaacaactgctgcaggtgcttttgcgtggagtgtgta
gatctcttggtggggccaggggctgcccaggcagccattaaggaagacccctggaactgc
tacatgtgtgggcacaagggcacctatgggctgctgcggcggcgggacgactggccctct
cggctccagatgttcttcgccaataaccacgaccaggaatttgaccctccaaaggtttac
ccgcctgtcccagctgagaagaggaagcccatccgggtgctgtctctatttgatgggatt
gctacagggctgctggtgctgaaggacctgggcattcaggtggaccgctacatcgcctcg
gaggtgtgtgaagactccatcacggtgggcatggtgcggcaccaagggaagatcatgtac
gtcggggacgtccgcagcgtcacgcagaagcatatccaggagtggggcccattcgatctg
gtgattgggggcagtccgtgcaatgatctctccatcgtcaaccctgcccgcaagggactc
tacgacagcccagctgacggctttctcttccgcctctcagagggcactggccggctcttc
tttgagttctaccgcctcctgcatgatgcgcggcccaaggagggagatgatcgccccttc
ttctggctctttgagaatgtggtggccatgggcgttagtgacaagagggacatctcgcga
tttcttgagtccaaccctgtgatgattgatgccaaagaagtgtcagctgcacacagggcc
cgctacttctgggggaaccttcctggtatgaacaggccgttggcatctactgtgaatgat
aagctggagctgcaggagtgtctggagcatggcagaatagccaagttcagcaaagtgagg
accattactactaggtcgaactccataaagcagggcaaagaccagcatttccccgtcttc
atgaatgagaaagaggacatcttatggtgcactgaaatggaaagggtgtttggcttccct
gtccactataccgacgtttccaacatgagccgcttggcgaggcagagactgctgggccgg
tcgtggagcgtcccggtcatccgccacctcttcgctccgctgaaggaatattttgcttgt
gtgtaa

DBGET integrated database retrieval system