KEGG   Pteropus alecto (black flying fox): 102887660
Entry
102887660         CDS       T02993                                 

Gene name
ATP7B
Definition
(RefSeq) copper-transporting ATPase 2 isoform X1
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102887660 (ATP7B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102887660 (ATP7B)
Enzymes [BR:pale01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     102887660 (ATP7B)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 HAD_2 Hydrolase_6 HAD
Other DBs
NCBI-GeneID: 102887660
NCBI-ProteinID: XP_006909066
LinkDB
Position
Unknown
AA seq 1546 aa
MAHGRGDSGRGAGGGVACDGQSALPPPVPSPTGRPRSRVLALSPDSATRWRPMGGPCASQ
IDFPGDLLGCGPNHRRNWFLREKMPEQEKQITAREGASRKILSKLPLPARGWEPAMKQSF
AFDNVGYEGGLDGTCPSQATTGTISILGMTCQSCVRSIEGRLSSLKGIVSIKVSLEQGSA
TVRYVPSVLSLPQVCYQIEDMGFEASITEGKAASWPSRSSPVPEAVVKLRVEGMTCQSCV
SSIEGKIRKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNKVAPVS
LGPIDIGRLQGTNPKTPSTCANQNANNSQTVMHQESHVVTLQLRVDGMHCKSCVRNIEEN
IGQLSGVQNIQVSLEERTAQVQYDLSRVSPGALQRAIEALPPGNFKVSLPDRAEGSGTDN
RSSTCHSPTPAQETQGQGACCTMVLAIAGMTCASCVQSIEGLISQREGVQRISVSLAEGT
GTILYDPSIINPEELQAALEDMGFEASVVSADCSASHVGNDSTVNVPVQTAAATPMSVQE
AALHAEVPPKHHSPRHSTKSPQASATMTPQKCFIQITGMTCASCVSNIERKLQKEAGILS
VLVALMAGKAEVKYNPEVIQPVEIAQLIQDLGFEATVMEDYTGSDGDLELIITGMTCASC
VHNIESKLVKTRGITHASVALATSKAHVKFDSEIIGPRDIVRIIEEIGFHASPAQRHPIA
HHLDHKVEIKQWKKSFLCSLVFGIPVMGLMIYMLILSNEPHESMVLDHNIIPGLSILNLI
FFILCTFVQFLGGWYFYIQAYKSLRHRTANMDVLIVLATSIAYVYSLIILVVAIAEKAER
SPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREE
QVPMELVQRGDVIKVVPGGKFPVDGKVLEGSTMADESLITGEAMPVTKKPGSTVIAGSIN
AHGSVLITATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVV
WIIIGFIDFGVVQTYFPTPSKHLSQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVG
TGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATLPLRKVLA
VVGTAEASSEHPLGAAITKYCKEELGMEALGYCMDFQAVPGCGIGCKVSNVEGILAHSEH
LSKRAAHLNGLGSVPVETDVDPQTFSVLIGNREWMRRNGLTISNDISDAMTAHEMKGQTA
VLVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQVGIKKV
FAEVLPSHKVAKVQELQKEGKKVAMVGDGINDSPALARADVGIAIGTGTDVAIEAADIVL
IRNNLLDVVAGIHLSKKTVWRIRLNLVLALIYNMVGIPIAAGVFMPFGIVLQPWMGSAAM
AASSVSVVLSSLQLKCYKKPDLEKYESWAQGHMKPLTESQVSVHVGMDDRWRDSPRATPW
DQVSFISQVSLSSLKSNKLSRHSAMADDSGDKWSLLLNDRDEEQCI
NT seq 4641 nt   +upstreamnt  +downstreamnt
atggcccatgggcggggcgatagtgggaggggcgctgggggaggcgtagcttgtgatgga
cagtcagctctcccgccccctgtgccctcccccactggaagaccccgttccagggtcctg
gccctcagtccagattctgccacccgttggagaccaatgggaggcccttgcgcgtctcag
atcgattttccaggtgaccttttgggctgtgggccgaatcacagaagaaattggttcctc
cgagagaagatgcccgagcaggagaaacagattacagctagagagggggccagtcggaaa
atcctatctaaacttcctttgcctgctcgtggatgggaaccagcaatgaagcagagtttt
gccttcgacaacgttggctacgaaggtggtctggatggcacgtgtccttcgcaggcgacc
actggcaccatcagcattttgggcatgacgtgccagtcatgcgtgaggtccatcgagggc
aggctttcaagtctgaaaggcatcgtgagcatcaaggtttccctggaacaaggcagcgca
accgtgagatatgtgccgtcggtcctgagcctgccacaggtgtgctatcaaattgaggac
atgggcttcgaagccagcatcacagaaggaaaggctgcctcctggccttcaaggtcctca
cctgtcccggaggccgtggtcaaactccgagtggagggcatgacctgccagtcttgcgtc
agctccatagaaggcaagattaggaaactgcaaggagtggtgagagtcagagtctccctc
agcaaccaagaggcagtcatcacttatcagccgtatcttattcaaccccaagacctcagg
gaccatgtaaacgacatggggtttgaagctgttatcaagaacaaagtggctcctgtcagc
ctgggaccgatagatattgggcggttacagggcaccaacccaaagacaccttcaacttgt
gctaaccagaatgccaataactctcagactgtgatgcaccaagagagccatgtggtcacc
ctgcaactgagagtagatgggatgcactgcaagtcttgtgttcggaatattgaagaaaat
atcggccaactttcaggggttcaaaatattcaagtgtccttggaggagagaaccgcccaa
gttcagtatgacctttctcgtgtctccccaggggctctgcagagggccattgaggctctt
ccaccagggaattttaaagtttcccttcctgacagggcagaaggaagtgggacagataac
aggtcttccacatgtcactcccccacccctgcccaggagacccaggggcaaggcgcctgc
tgtaccatggtgcttgccattgctggcatgacctgtgcatcctgtgtccagtccatcgaa
ggcctgatctcccaaagggaaggagtgcagcgaatatcagtctctctggccgaagggact
ggaacgattctctatgatccctctataattaacccagaagaactccaagctgctctagaa
gatatgggatttgaggcttcggtcgtttctgcagactgttctgccagccatgttggaaac
gatagcaccgtgaatgtcccagtgcaaactgcagctgccacacccatgtctgtacaggaa
gcggcactccacgcggaggtgccccctaaacaccacagccctcgccactcgacgaagtcc
ccgcaagcctccgcaacaatgacaccacagaaatgctttatacagatcacaggcatgacc
tgtgcatcctgtgtgtctaacattgagagaaagctgcagaaagaagccggtattctctcc
gtgctggttgccttgatggccggaaaggcagaggttaaatataatccagaagtcatccag
ccagtcgagatagctcagctcatccaggacttgggctttgaggcaacagtaatggaggac
tacacaggctcagatggcgaccttgagctgattatcactgggatgacctgcgcttcctgc
gttcacaacatagagtccaaacttgtgaagacgagaggtatcacccatgcctccgtggcc
cttgcaaccagcaaagcccacgtgaaatttgattctgaaattatcggtccgcgtgatatt
gtcagaattattgaggaaatcggctttcatgcttccccggcccagagacaccccatcgct
catcacctggaccacaaggtggagataaagcagtggaagaagtctttcctgtgcagcctg
gtgtttggcatccctgttatgggtttaatgatctatatgttgatactcagcaacgaaccc
catgagtccatggtcctggaccacaacatcattccaggactgtctattctaaatctcatc
ttctttatcttgtgtacctttgtccagttccttggcggatggtacttctacattcaggcc
tacaaatctctgcgtcacaggacagccaacatggacgtgcttatcgtgctggccactagc
attgcctatgtttactctctcatcatcctggtggtggccattgccgagaaggccgagagg
agccccgtgacattctttgacactccccccatgctcttcgtgttcatcgccctagggcgg
tggctggaacatgtggcaaagagcaaaacctcagaagctctcgccaaactcatgtctctc
caagccacggaagccaccgttgtgactctcggtgaagacaacttaatcatcagagaggag
caagtacccatggagctggtgcagcggggtgatgtcatcaaggttgttcctgggggaaag
ttcccagtggatgggaaagtcctggagggcagtaccatggccgatgagtccctcatcaca
ggagaagccatgccagtcactaagaaacctggaagcacagtgattgccgggtctataaat
gcacacggctctgtgctcatcactgccacccatgtgggcaatgataccactttggctcag
attgtgaaattggtggaagaggctcagatgtcaaaggcacccattcaacaactggctgac
cggtttagtggatattttgtcccatttatcatcatcatttcaactttgacgttggtggta
tggattataatcggttttatcgattttggtgttgttcagacatactttcctacccccagc
aagcacctctcccaggcagaggtgatcatccggttcgcgttccagacgtccatcacagtg
ctgtgcatcgcctgcccctgctctctgggcctggccacacccacagcagtcatggtgggc
acgggtgtggccgcccagaacggcatcctcatcaagggaggcaagcccctggagatggcc
cacaagataaagactgtgatgtttgacaaaactggcaccattacccacggggtccccaaa
gtcatgcgggtcctcttgcttgtggatgtggccacgctgcccctcaggaaggttcttgct
gtggtggggactgcagaggcgagcagcgagcaccccttaggtgcggccatcaccaaatac
tgtaaagaggaacttggaatggaggccttgggatactgcatggacttccaggccgtgcca
ggctgtggaatcggctgtaaagtcagcaacgtggaaggcatcctagcccacagcgagcac
ctgagcaaacgggccgctcacctgaacgggcttggcagtgttcccgtggaaacagatgtg
gatccccagaccttctctgtgctgattggaaaccgagaatggatgagacgcaacggcttg
accatttccaacgacatcagtgacgcaatgacagcccatgagatgaaaggccagacagcc
gtcttggtggctattgatggggtgctctgtgggatgattgccatcgcagacgccgtcaag
caggaggccgccctggctgtgcacacgctgaagagcatgggtgtggacgtggttctgatc
acgggggacaaccgcaagacagccagagccattgccacccaggttggcatcaagaaagtc
tttgcagaggtgctgccttctcacaaagtggccaaggtccaggagctccagaaggaaggg
aagaaagttgccatggtgggagatgggattaacgactccccggccttggcccgggccgac
gtgggcatcgccatcgggacgggcaccgatgtcgccatcgaggcagctgacattgttctc
atcagaaacaacctgctcgacgtagtcgctggcattcacctctccaagaagacagtctgg
agaatacggctcaacctggtgctggcgctgatttataacatggttggaatccccatcgca
gcaggagtcttcatgccctttggtattgtgctgcagccgtggatgggctcggcggccatg
gcagcctcttctgtgtctgtggttctctcatcgctgcagctgaagtgctataagaagccc
gacctggagaagtacgagtcctgggcccaaggccacatgaagcccctgaccgagtcccag
gtcagcgtgcatgtcggcatggatgaccggtggcgggactccccaagggccacaccctgg
gaccaggtcagcttcatcagccaggtgtctctgtcctccctgaagtccaacaagctatcg
cggcacagcgccatggctgatgatagtggggacaagtggtctctgctcctgaatgacagg
gatgaggagcagtgcatctga

KEGG   Pteropus alecto (black flying fox): 102888320
Entry
102888320         CDS       T02993                                 

Gene name
ATP7A
Definition
(RefSeq) copper-transporting ATPase 1 isoform X1
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102888320 (ATP7A)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102888320 (ATP7A)
Enzymes [BR:pale01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     102888320 (ATP7A)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2
Other DBs
NCBI-GeneID: 102888320
NCBI-ProteinID: XP_006910261
LinkDB
Position
Unknown
AA seq 1500 aa
MDPSMSVNTVTISVEGMTCSSCVWTIEQQIGKLNGVYHIKVSLEEKSAAIIYDSKLQTPK
TLQKVIDDMGFDAILYNSNPLPVLTDTVFLTVTTSLAPPWDHIQSTLLKTKGVTDIKISP
QQRTAVVTIIPSLVNANQIIELVPDLSLDTGALEKKSGTFEDYSMAQAGEVMLKMKVEGM
TCHSCTSTIEGKIGKLQGIRRIKVSLDNQEATIVYQPHLITVEEIKKQIEAAGFPAFIKK
QPKYLTLGAIDIERLKNAPVKSSEGSQQRSPSYTNDSTITFIIDGMHCKSCVSNIESVLS
TLQYVSSTVVSLENRSAIVKYNASSITPETLRKAIEAISPGQYRVSITSEVESSSDSPSC
SSLQKIPLNIVSQPLTQETVIDIDGMTCNSCVQSIEGVISKKAGVKSIRVSLANGNGTVE
YDPLLTSPETLRDAIEDMGFDAALSDSNEPLVVIAQPSSEMPLLTSTSEFYTKIMTPIHD
KEDVKTSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPP
MIAEFIRELGFGTTVIENASEGDGVLELVVRGMTCASCVHKIESTLTKHRGIFYCSVALA
TNKAHIKYDPEIIGPRDIIHTIKSLGFEASLVKKDRSASHLDHKREIRQWRQSFLVSLFF
CIPVMGLMIYMMVMDHHLATLHHNQNMSQEEMVNVHSSMFLERQILPGLSIMNLLSFVLC
VPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITF
FDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLGSDNILLSEEQVDVE
LVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKSGSTVIAGSINQNGSL
LIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIISIVTLLVWIIIG
FLNFQVVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGA
QNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNRISCNKILAIVGTA
ESNSEHPIGAAITKYCKQELDTDTLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWKIEEN
NIKNASLVQIDTSNEQSSTSSSMIINAQLSNDLNTQQYKVLIGNREWMIRNGLVISNDVD
DSMTEHERRGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKT
ARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMIGDGINDSPALAMANIGIAIGT
GTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPI
GLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYETYELHARSQMGQKSPSEISVHVGI
DDISRNSPKLGLLDRFVNYSRASINSLLSDKRSLNSVGTGEPDKHSLLVGDCREDDDTAL
NT seq 4503 nt   +upstreamnt  +downstreamnt
atggatccaagtatgagtgtgaatactgtcaccatctctgttgaagggatgacatgtagt
tcctgtgtttggaccattgagcagcagattggaaaactgaacggtgtatatcacattaaa
gtttcactggaagaaaaaagtgcagcaattatttatgactctaaactacagactccaaag
accctacagaaagttattgatgacatgggctttgatgctattctctacaattctaaccct
ctccctgttttaaccgatactgtgtttctgactgttactacttcactggctccaccatgg
gaccacatccaaagcacattactcaagaccaagggtgtgacagacattaaaatttcccct
cagcaaagaactgcagtggtgacaataattccttctttagtgaatgccaatcagataata
gagctggttccggatctcagtttagatactggagctctggagaaaaagtcaggaaccttt
gaagattatagtatggctcaagcaggtgaagtcatgctaaagatgaaagtggaagggatg
acctgccattcatgcactagcaccattgaaggaaaaattgggaaactgcaaggtattcgg
cgaattaaagtctccctggacaaccaagaagctactattgtttatcaacctcatcttatc
acagtagaggaaataaaaaaacaaattgaagctgcaggttttccagcattcatcaaaaaa
cagcccaagtacctcacgttgggagctattgatatagaacgtctaaagaatgcaccagtc
aaatcctcagaaggatcacaacaaaggagcccatcatatacgaatgattctacaatcact
ttcatcatagatggcatgcattgtaaatcatgtgtgtcaaatattgaaagtgttttatct
acactccaatatgtaagcagcacagtagtttctttagagaatagatctgctatagtaaag
tacaatgcaagctcaatcactccagaaaccctgagaaaagcaatagaggccatatcacca
gggcaatatagagttagtattacaagtgaggttgagagtagctcagactctccgtcctgt
tcatctcttcaaaagattcctttgaacatagttagccagcctctaactcaagaaactgtg
atagacattgatggcatgacttgtaattcttgcgtacagtctattgagggtgttatatca
aaaaaggcaggtgtaaaatccatacgagtatcccttgcaaatggcaatggaactgttgag
tatgatcctctactaacctctccagaaactttgagagatgcaatagaagacatgggattt
gatgctgccttgtcagattcaaatgagccattggtagtaatagctcagccctcatcggaa
atgccacttttgacctcaactagtgaattttatactaaaataatgacaccaattcacgac
aaggaggacgtaaagacttcatctaagtgttacatacaggtcactggtatgacttgcgct
tcctgtgtagcaaacattgaacggaatttaagacgagaagaaggaatatattctgtactt
gtggctctgatggctggaaaggcagaagtaagatataatcctgctgttatacaacccccg
atgatagcggagttcatacgagaacttggatttggaaccactgtgatagaaaatgccagt
gaaggagatggtgttttggaacttgttgtgagaggaatgacatgtgcctcctgtgtacat
aaaatagagtctaccctcacaaaacacagagggatcttctactgttctgtggccctggca
accaacaaagctcatattaaatatgatccagaaattattggtcccagagatattatccat
acaattaaaagcttaggttttgaagcatctttagtcaagaaggatcggtcagcaagccac
ctagaccataaacgagaaataaggcaatggagacagtccttccttgtgagcctgtttttc
tgtattcctgtaatggggctgatgatatatatgatggttatggatcatcaccttgcaact
cttcaccataatcagaacatgagtcaagaagaaatggtcaacgttcattcttctatgttc
ctggagcgccagatactgccaggattgtccattatgaatttgctgtccttcgtattgtgt
gtacctgtacagttttttggaggctggtacttctacattcaagcctacaaagcgctgaag
cataaaactgcaaatatggatgtactaattgtgctagccaccaccattgcatttgcctac
tctttggttattcttctggttgcaatgtatgagcgagccaaagtgaaccctattactttc
tttgacacacctcctatgctgtttgtgtttattgcactaggccggtggctggaacatata
gcaaagggcaaaacatcggaggctcttgccaagctaatttcactacaagcaacagaagca
actattgtaactcttggctctgataatatcctcttgagtgaagaacaagtggatgtggaa
cttgtacaacgtggagacatcattaaagtggttccaggaggcaaatttccagtggatggt
cgtgttattgaaggacattctatggtagatgagtctctcatcacaggggaggcaatgcct
gtagctaagaaatctggcagcacagtgattgctggttccattaaccagaatgggtcacta
cttatccgtgcaacccacgtaggagcagacacaaccctttctcaaattgtcaaacttgtg
gaggaggcacaaacatcaaaggctcctattcagcagtttgcagacaaactcagtggctac
tttgttccttttattgttattatttccattgttaccctcttggtttggattataattgga
tttctgaattttcaagttgtggaaacgtactttcctgggtacaacagaagtatctcccga
acagaaacgataatacgctttgctttccaagcctctatcacagttctgtgcattgcatgc
ccttgttcactgggactggccactccaactgctgtcatggtgggtacaggagtaggtgct
caaaatggcatactaatcaaaggtggcgagccactggagatggctcataaggtaaaagta
gtggtatttgataagactggaaccattacccatggaaccccagtagtgaatcaagtaaag
gttctggtggaaagtaacagaatatcatgcaataagatcctggccattgttggaactgct
gaaagtaacagtgaacaccctatcggagcagccataaccaaatactgcaagcaggagctg
gacactgataccttgggtacctgcatagatttccaggttgtgccaggctgcggtattagc
tgtaaagtcaccaatattgaaggcttgctgcataagaataactggaagatagaggaaaat
aatattaaaaatgcatccctggttcaaattgatacaagtaatgaacagtcatcaacttcg
tcttccatgattattaatgcccagctctcaaatgatcttaatactcagcaatataaagtc
ctcattggtaaccgggagtggatgattagaaatggtcttgtcatcagtaatgatgttgat
gattccatgactgaacatgagagaagaggtcgaactgctgtattggtggcagttgatgat
gagctgtgtggcttgatagctattgctgatacagtgaagcctgaagcagaactggctgtc
catattctgaaatctatgggcttagaagtagttctgatgactggagacaacagtaaaaca
gctagatctattgcttctcaggttggcattactaaggtatttgctgaagttctaccttct
cacaaagttgctaaggtgaaacaacttcaagaagaggggaaacgggtagcaatgatagga
gatggaatcaatgactccccagctctggcaatggctaatattggaattgccattggcaca
ggcacagatgtagctattgaagcggctgatgtggttttgataaggaatgatcttctggat
gtagtggcaagtattgacttatcaaggaagacagtcaagaggattcggataaattttgtc
tttgctctaatttataatctggttggaattcccatagcagctggagtgtttatgcccatt
ggtttggttttgcaaccttggatgggatccgctgcaatggctgcttcatctgtttcagta
gtactttcttctctcttccttaaactttacaggaaaccaacttacgagacttatgaactg
catgcccgaagccagatgggacagaaaagtccttcagaaatcagcgttcatgttggaata
gatgatatctcaagaaattctcctaaactgggtttactggaccggtttgttaattacagc
agagcctccataaactcactactgtctgataaacggtccctaaacagtgttggtactggt
gaacctgacaagcactcactactggtgggagactgcagggaagatgacgacactgcattg
taa

DBGET integrated database retrieval system