KEGG   Pteropus alecto (black flying fox): 102887662
Entry
102887662         CDS       T02993                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04915  Estrogen signaling pathway
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102887662 (TGFA)
   04012 ErbB signaling pathway
    102887662 (TGFA)
   04014 Ras signaling pathway
    102887662 (TGFA)
   04151 PI3K-Akt signaling pathway
    102887662 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102887662 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887662 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102887662 (TGFA)
   05212 Pancreatic cancer
    102887662 (TGFA)
   05225 Hepatocellular carcinoma
    102887662 (TGFA)
   05214 Glioma
    102887662 (TGFA)
   05211 Renal cell carcinoma
    102887662 (TGFA)
   05215 Prostate cancer
    102887662 (TGFA)
   05223 Non-small cell lung cancer
    102887662 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102887662 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 102887662
NCBI-ProteinID: XP_006909571
LinkDB
Position
Unknown
AA seq 160 aa
MVTSAGQLTLFALGLLLAVCQALENTTSALSADPPMAAAVVSYFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVASSQKKQAITALVVVSIVALAGLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcaccctgttcgcgctgggtcttttgttggctgtgtgc
caggccctggagaacaccacatccgccttgagcgcagacccgcccatggccgcagctgtg
gtgtcttattttaatgactgcccggattctcacagtcagttttgcttccacggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgtcggagcg
cgctgtgagcacgcggacctcctggctgtggtggcctccagccagaagaagcaggccatc
actgccttagtggtggtctccattgtggccctggctggcctcatcatcacgtgtgtactg
attcattgctgccaggtccgaaaacactgtgagtggtgccgggcactcatctgccggcac
gagaagcccagtgccctcctgaaaggaaggactgcttgctgccactcagaaacagtggtt
tga

DBGET integrated database retrieval system