KEGG   Pteropus alecto (black flying fox): 102887872Help
Entry
102887872         CDS       T02993                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale05034  Alcoholism
pale05165  Human papillomavirus infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102887872 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    102887872 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    102887872 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:pale01009]
    102887872 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:pale03019]
    102887872 (HDAC6)
   04131 Membrane trafficking [BR:pale04131]
    102887872 (HDAC6)
   03036 Chromosome and associated proteins [BR:pale03036]
    102887872 (HDAC6)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102887872 (HDAC6)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102887872 (HDAC6)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102887872 (HDAC6)
Membrane trafficking [BR:pale04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102887872 (HDAC6)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102887872 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 102887872
NCBI-ProteinID: XP_006922811
UniProt: L5JWM2
LinkDB All DBs
Position
Unknown
AA seq 1140 aa AA seqDB search
MTSTGQDSTTTKQRSRHNPHSTPHDSNVTSKRGTKKGATLHSSPKLAEVKKKGRMKKLSQ
ATGQDLIVGLQGLDLNVEAKTLSGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQ
EGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRILADTYDSVYLHPNSY
TCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQK
HGIQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQ
GYTINVPWNQVGMRDADYIAAFLQVLLPVALEFHPQLVLVAAGFDALQGDPKGEMAATPA
GFAQLTHLLMGLAGGRLILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGAPCPSAQ
SSLSCALEALEPFWEVLVRSGETREEDNVERDNAEEEEEEEEEPWQPPELPILTWPVLQA
RTGLVYDQQMMGHYNLWDNHHPEMPQRISQIMCRLEELGLSRRCLILPARPATDAELLTC
HSAEYVGRLRATEKMKPRELHREGANFDSIYICPSTFACAKLAAGSTCCLVEAVLAGEVL
NGVAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQVISGHALRILIVDWDVHHGNGTQHI
FEEDPSILYISLHRYDHGTFFPMGDEGASNQVGWAAGMGFTVNVAWNGPRMGDAEYLAAW
HRVVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILE
GGYNLTSISESMAACTRTLLGDPPPLLTLPRPPLSGALASIAKTIQIHRKYWRSLRVTKF
EDKEGPSSSKLTKEAPQPANPESAERLTTLEGNILDASTEKDTSASSVQESTPAQTKSQT
DVVERTQDQPSEAAKGEPMLDKTTSEAATPDQTTSEAAMLGQTTSEEAAEIAKLIQTPPA
SPVQGATAQISLSKLIGNLRTLELDNKAQEAPESQIPEEERLLGEAAGGQDVDNSVLMQA
FGNTDQVMFYAVTPLPWCPHLVAVCPIPEAGLDVTQPCQDCGALQENWVCLSCYEVYCGR
YISAHMLQHYEVSGHPMVLSYVDLSTWCYQCQAYVHHQALLDVKNVAHQNKFGEDMPHSH
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgacctccactggccaggattccaccacaaccaagcagcggagtaggcacaacccccac
tcgaccccccacgactccaacgtcacctcgaagcgaggtactaagaagggtgccacgctc
cactccagccccaaactagcagaagttaagaagaaaggcagaatgaagaagctcagccag
gcaacagggcaagacctaatcgtggggctgcaagggctggatctgaacgttgaggccaag
acactgtctggtactggcttggtgttagatgagcagctcaatgaattccactgcctctgg
gatgacagcttccctgaaggccccgagcggctccatgccatcaaggaacaactgatccag
gagggcctcctggaccgctgtgtgtcctttcaggcccggtttgctgaaaaggaggagctg
atgttggttcacagcctagaatacattgatctgatggagacaacccaatacatgaatgag
ggagaactccgtatcctagcagacacctatgactcagtttatctgcatccgaactcatac
acctgcgcctgcctggcttcaggctccgtcctcaggctggtggatgcagtcctgggggca
gagatccggaatggcatggccatcatcaggcctcctggacaccacgcccaacacagtctc
atggacgggtattgcatgttcaaccatgtggccgtggctgcccgctacgctcaacagaag
catggcattcagagggtccttatcgtggattgggatgtacaccacggtcagggaacacag
ttcacctttgaccaagaccccagcgtgctctatttctccatccaccgctacgagcagggt
cggttctggccccacctgaaggcctctaactggtccaccacaggttttggccagggacag
ggatacaccatcaatgtgccttggaaccaggtggggatgcgagatgccgactacatcgct
gctttcctgcaagtcctactgccagtcgcccttgagttccacccccagctggtcctggtg
gctgctggatttgatgcccttcaaggggaccccaagggtgagatggctgccactccggca
gggtttgcccagctaacccatctgctcatgggtctggcaggaggcagactgatcctgtct
ctggagggtggctacaacctccgctccctggctgagggcgtcagtgcctcacttcacacc
ctcctgggagacccttgccccatgctggagtcccctggtgccccctgcccaagtgcccag
tcttcactgtcctgcgctctggaagccctggagcccttctgggaagtccttgtgagatca
ggtgagacccgggaggaggacaacgtggagagggacaatgcagaagaggaggaagaggag
gaggaggaaccatggcagccccctgagctcccaatcctgacgtggccagtgctgcaggct
cgcacagggctggtctacgaccaacagatgatgggtcactacaacttgtgggataaccac
caccccgagatgccccagcgcatctcacagatcatgtgccgtctggaggagctgggcctt
tctaggcgctgcctcatcctgcctgcacgtcctgccacagacgctgagctgctcacctgc
cacagtgctgagtatgtgggtcgtctgcgggccacagagaagatgaaaccccgggagctg
caccgcgagggtgccaactttgactccatctacatatgccccagcaccttcgcctgtgcg
aagctggctgccggctccacatgctgccttgtggaggctgtgctggcaggagaggttttg
aatggtgttgctgtggtgcgtcctccgggacaccatgcagaacaggatgctgcctgtggt
ttctgctttttcaactctgtagctgtggctgctcgccatgcccaggtcatcagtgggcat
gctctgcggattttgatcgtggattgggacgtccatcacggtaatggaactcagcatata
tttgaggaggatcccagcatactctacatttccctgcaccgctatgatcatggcaccttc
tttcccatgggggatgagggtgccagcaaccaggtgggctgggccgcgggcatgggcttc
actgtcaatgtggcctggaatgggccccgcatgggtgacgctgagtacctggctgcttgg
catcgtgtggtgcttcccattgcctacgagtttaatccagaactggtgctagtctcagct
ggctttgatgcagcacggggggacccgttggggggctgccaggtatcacctgagggctat
gcccatctcacccacctgctgatgggccttgccagtggccgcattatcctaatcctagag
ggtggctataacctgacatccatctcagagtccatggctgcctgcacccgtaccctcctt
ggggacccgccacccctgctgaccctgccacggcccccactatccggggccctggcctcg
attgctaagaccatccaaatccatcgcaaatactggcgcagcttacgggtcacaaaattc
gaagacaaggagggaccctccagttctaagttgaccaaggaggcaccccaaccagcaaat
cctgagtcagctgagaggctgaccacactagaagggaacattctggatgcaagcacagaa
aaggacacctcagcatcatctgttcaagagtctactccagcccagactaagtcacagacg
gatgtggtagagcgcactcaggaccagccctcagaggcagccaagggggaacccatgctg
gacaagaccacctcagaggcagccacgccagaccagaccacctcagaggcagccatgctg
ggccagaccacctcagaggaggctgcggaaattgccaagctgatccaaacccctccagcc
tcacctgtgcaaggagccacagcccagatatccctaagtaagctgattgggaatctcagg
accttggaactagacaacaaggctcaggaggccccagagtctcagatcccagaagaggag
aggctacttggagaagcagctggaggtcaggacgtggataattcagtgctgatgcaggcc
tttgggaacactgaccaggtcatgttttatgctgtgacaccactgccttggtgtccccat
ttggtggcagtatgccccattcctgaagcaggcctggacgtgacccagccttgccaggac
tgtggagcactccaggagaactgggtgtgtctgtcttgctatgaggtctactgtggtcgt
tacatcagtgcccatatgctacagcactacgaagtctcaggacacccaatggtcctcagc
tatgtcgacctttctacctggtgttaccaatgtcaggcctatgtccaccatcaggctctc
ctagatgtgaagaacgtcgcccaccaaaacaagtttggggaggacatgccccactcacac
taa

DBGET integrated database retrieval system