KEGG   Pteropus alecto (black flying fox): 102888463
Entry
102888463         CDS       T02993                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04024  cAMP signaling pathway
pale04260  Cardiac muscle contraction
pale04261  Adrenergic signaling in cardiomyocytes
pale04371  Apelin signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04919  Thyroid hormone signaling pathway
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04972  Pancreatic secretion
pale04976  Bile secretion
pale05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102888463 (SLC9A1)
   04024 cAMP signaling pathway
    102888463 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102888463 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102888463 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102888463 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    102888463 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    102888463 (SLC9A1)
   04971 Gastric acid secretion
    102888463 (SLC9A1)
   04972 Pancreatic secretion
    102888463 (SLC9A1)
   04976 Bile secretion
    102888463 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102888463 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102888463 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102888463 (SLC9A1)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102888463 (SLC9A1)
Transporters [BR:pale02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   102888463 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 102888463
NCBI-ProteinID: XP_006924435
UniProt: L5JRM7
LinkDB
Position
Unknown
AA seq 814 aa
MLSWSGICGLSPPRIFPSLLIGVALVGLLPVLRSHGLQSSPTASTIRGSEPPRERSIGDV
TTAPPELVPDSRPVNHSVTEHSMKARKAFPVLGIDYTHVRIPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSKVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRVGIVDIVLGFLSFFV
VSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITID
PASPQSPESVDLVNEELKGKVLGLNRDPRVAEEDEDDDGGIVIRTKEPSSPGTDDVFTPG
PSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgctttcgtggtctggcatctgtggcctctctccacctcgaatcttcccttcgttgctc
ataggggtagccttggtggggctgctgcctgttctcaggagccatggcctccagtccagc
cctactgccagcaccatccgaggctcagagccaccacgggaacgctctattggagatgtc
accaccgccccaccggagctcgtccccgacagccgccctgtcaaccattctgtcactgaa
cacagcatgaaggctcgaaaggcctttccagtcctgggcatcgactacacacatgtgcgc
atacccttcgagatctccctctggatcctgctggcctgcctcatgaagataggtttccat
gtgatccccactatctcgagcatcgtcccggagagctgcctgctgattgtggtggggctg
ctagtagggggcctgatcaagggtgtgggcgagacaccccccttcctgcagtcaaaagtc
ttcttcctcttcctgctgccgccaatcatcctggacgcaggctacttcctgccgctgcgg
cagttcacagagaacctgggcaccatccttatcttcgccgtggtgggcacactatggaat
gcctttttcctgggtggcctcatgtatgctgtgtgtctggtgggcggcgagcagatcaac
aacattggccttctggacaacctgctcttcggcagcatcatctcagccgtggaccctgtg
gccgtgctggctgtcttcgaggaaattcacatcaacgagctgctacacatcctcgtcttc
ggggagtccctgctcaatgacgctgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaccgcgtgggcatcgtagacatcgtcctcggcttcttgagcttcttcgtg
gtgtccctgggaggagtctttgtgggcgtggtctacggggtcatcgccgccttcacctcg
cgattcacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacctgtctgccgagctcttccacctttcaggcatcatggcactcattgcctcggga
gtggtgatgcgcccctacgtggaggctaacatctctcataagtcccacacgaccatcaag
tatttcctgaagatgtggagcagcgtcagtgagaccctcatcttcatcttccttggtgtc
tccaccgtggctggctcccaccactggaactggacctttgtcatcagcaccctgctcttt
tgcctcatcgctcgcgtgctgggcgtgctgggcctgacctggttcatcaacaagtttcgc
atcgtgaagctgacccccaaggaccagttcatcattgcctatgggggcctgcgaggggcc
atcgccttctccttgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcaccgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtcgacctgttggctgtgaagaaaaagcaagaaacaaagcgctccatcaacgag
gagatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggccaccaccactggaaggacaagctcaaccgctttaataagaagtacgtgaagaag
tgtctgatagccggcgagcgctccaaggagccccagctcatcgctttctaccacaagatg
gagatgaagcaggctatcgagctggtggaaagtggcggcatgggcaagatcccctcagct
gtctcgactgtttccatgcagaacattcaccccaagtccctgcctgctgagcgcatccta
ccagcactctccaaggacaaggaagaggagatccgcaaaatcctgaggaacaacctgcag
aagaccaggcagcggctgcgatcttacaacaggcacacgctggtggcggacccctacgag
gaggcctggaaccagatgctcctccgcagacagaaggcccggcagctggagcagaagatc
aacaactacctgacggtgccagcccacaagctggactcacccaccatgtctcgggcccgc
attggctcagacccgctggcctatgagccgaaagccgacttgcctgttatcaccatcgac
ccagcctccccacagtcgcctgagtctgtggacctggtgaatgaggagctgaagggcaag
gtcctggggctgaaccgggaccccagggtggccgaggaggacgaggacgatgacgggggc
attgtgatacggaccaaagagccctcttccccaggcactgacgatgtcttcacccctggg
ccaagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggcccccac
cctgagcctggggagggagagcctttcatccccaaggggcagtag

DBGET integrated database retrieval system