KEGG   Pteropus alecto (black flying fox): 102888616
Entry
102888616         CDS       T02993                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X2
  KO
K08015  Ras association domain-containing protein 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04218  Cellular senescence
pale04670  Leukocyte transendothelial migration
pale05200  Pathways in cancer
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102888616 (RASSF5)
   04015 Rap1 signaling pathway
    102888616 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102888616 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102888616 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888616 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102888616 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 PHD
Other DBs
NCBI-GeneID: 102888616
NCBI-ProteinID: XP_006922893
LinkDB
Position
Unknown
AA seq 418 aa
MAMASPAIGQRPYRLLLDPEPPRYLQSLSGPEPPPPPPPPSSRRCATAPLSPAPGAHEGR
GARRATRGDPEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELALRSGRGWCDLCGQEVLQQALRCANCKFTCHPECRNLIPGLHREQEGPSRNR
PSPESTLTPTFSQNVCKPAEEARRPPTLQEIKQKIASYNSREKNCLGMKLSEDGTYTGFI
KVHLKLLRPVTVPAGIRPQSIYDAIKDVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKQTHKDGQVLFQKLSIADCPLYLRLLAGPDTDVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRKSQGKPG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtaccggctgctcttggacccagaa
ccgccgcgctatctgcagagcctgagcggccccgagccgccgccgccgccgccgccgccg
tcctcgcgccgctgcgccactgcgcctctgtcccctgcgcccggggcgcacgaggggcgt
ggtgcccgaagggctacccgcggggacccggagcccccaccccgggcctcccgccccgct
cgccctctccggcctggactgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatccccgcgtcccggcggaacgaggc
gaggggcactgcttcgcggaactggcactacggagcggccgaggctggtgtgacctgtgc
ggacaagaggtgctgcagcaggcgctgcgctgcgctaactgtaaattcacctgccacccg
gagtgccgcaatctgatccctggactgcacagggagcaggaaggcccatcccggaacaga
ccgtctccagaaagcaccctcactccgaccttcagccagaatgtctgtaaacctgcagag
gaggcacggcgcccgcccacactgcaggagatcaagcagaagatcgccagctacaacagc
cgggagaagaactgcctgggcatgaagctgagtgaagatggcacttacacgggtttcatc
aaagtgcatttgaaactgctgcggccagtgacagtgcctgctgggatccggccccagtcc
atatatgacgccatcaaggacgtgaatctggcggccaccacagacaagcggacatccttc
tacctgccactggatgccatcaagcagctacacatcagcagcaccaccacagtcagtgag
gtcatccaggggctgctcaagaagttcatggtcgtggacaatccccagaagtttgcactt
tttaagcagacacacaaggatgggcaagtgctcttccagaaactctccatcgctgactgc
cccctctacctgcgcttacttgctgggcctgacaccgatgtcctcagctttgtgctaaag
gagaacgagaccggagaggtggagtgggacgccttctccatccctgagctccagaacttc
ctaacgatcctggaaaaagaggagcaagacaaaatccaacaagtgcagaagaagtatgac
aagtttaggcagaaactggaggaggccttaagaaaatcccagggcaaacctggctaa

DBGET integrated database retrieval system