KEGG   Pteropus alecto (black flying fox): 102888944Help
Entry
102888944         CDS       T02993                                 

Gene name
LIG1
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03030  DNA replication
pale03410  Base excision repair
pale03420  Nucleotide excision repair
pale03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102888944 (LIG1)
   03410 Base excision repair
    102888944 (LIG1)
   03420 Nucleotide excision repair
    102888944 (LIG1)
   03430 Mismatch repair
    102888944 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102888944 (LIG1)
   03400 DNA repair and recombination proteins [BR:pale03400]
    102888944 (LIG1)
Enzymes [BR:pale01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102888944 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102888944 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102888944 (LIG1)
DNA replication proteins [BR:pale03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102888944 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102888944 (LIG1)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102888944 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102888944 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102888944 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 102888944
NCBI-ProteinID: XP_024904617
LinkDB All DBs
Position
Unknown
AA seq 944 aa AA seqDB search
MQRSIMSFFYPKTEGKAKKPEEETPSSVGETEPPPKAALKERNGMVPESDSPVKRPGRKA
ARVLGSEGEEEDGARTPPWGQKRGGLAPGAQPGSGPRLPARHPEAAHRPWETCPGHGELA
ATADIWDHELPKRRTARKQLPKRTRGGEQSEDEDREAKRKKEGASNGNPASQKYSVRKKK
ECDLILKTEIPRAKAETPTESPPESEGAEEKEAEEEDLPTVPPELPEACEAEPGAAVGQG
LREEDRAKPPARGPKTLSSFFAPRKPAVKTEVKEEGSGTPRKEAPEGPPEPSGYNPAQNS
YHPVEDACWKQGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPSDLLPILY
LSLNHLGPPQQGLELGIGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRL
MLPPPTLTASGVFAKFRDIARLTGSASTAKKIEIIKGLFVACRHSEARFIARALSGRLRL
GLAEQSVLAALAQAVSLTPPGQGFPPAVVDAGKGRTAEARKTWLEEQGMILKQTFCEVPD
LDRVVPVLLEHGLERLPEHCRLSPGVPLKPMLAHPTRGVGEVLKRFEEAAFTCEYKYDGQ
RAQIHLLEGXXXXXXQEDNTGKYPDIISRIPKIKLPSVTSFILDAEAVAWDREKKQIQPF
QVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNGESLVRGPLSRRRQLLRENFMETEGEFVF
ATSLDTKDTDQIAEFLEQSVRDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGD
TLDLVVIGAYLGRGKRAGRYGGFLLAAYDEDSEELQAICKLGTGFSDDALEEHHHRLQAL
VLPSPRSYVRADGAVAPDHWLEPSAVWEVKCADLSLSPIYPAARGLVDSEKGVSLRFPRF
IRVREDKKPEEATTSAQVACLYRKQSQVQNQQGSHSESDPEDFY
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcatgtcatttttctaccccaagacagagggcaaagcgaagaagcca
gaggaggagacgcccagcagcgtcggggaaacagagcccccgccgaaggcggcgctgaag
gagaggaacggaatggtgcctgagagcgactctccggtgaagaggccggggaggaaggcg
gcccgcgtcctgggcagtgagggggaggaggaggacggagcccgcacgcccccctggggc
cagaagcgtggtggcctcgccccgggagcgcagcccggctccggcccgcgcctccccgcc
cggcatcccgaagcggcgcacaggccctgggagacctgtccgggacatggggagctggcg
gccactgctgacatttgggatcatgaactcccgaagcggcgcacagctcggaagcagctt
cctaaacggacacgtggcggggagcagagcgaggacgaggacagagaagccaagaggaag
aaggagggagccagcaatggaaacccagcttcgcagaaatacagcgtcaggaagaagaag
gaatgcgacctgatactgaaaactgaaataccccgagctaaagcagagaccccaacagaa
agtcccccagaatcggaaggggccgaagagaaggaggcagaagaggaggacctgcccacg
gtgccccccgagctccccgaggcctgcgaagcagagcccggggcggccgtgggccagggg
ctgcgggaggaggaccgggcgaagcctcccgccaggggtcccaagacgctcagcagtttc
ttcgctccccggaagccggcagtcaaaacagaagtgaaagaagaggggtctggcacccca
aggaaggaggcgcccgagggcccgccggagccatccggctacaatcctgcccagaacagc
taccatcccgttgaagacgcctgctggaagcagggccaaaaagtcccttatctggcagtg
gcccggacgttcgagaagatcgaggaggtttctgctcggctccgcatggtggagacgctg
agcaacctgctgcgctccgtggtggccctgtcgccgtctgacctcctccccatcctctac
ctcagcctcaaccacctggggccgccccagcagggcctggagcttggcattggggacggt
gtccttctcaaggcagtggcccaggccacaggtcggcagctcgagtctgtccgggctgag
gcagctgagaagggtgacgtgggcctggtggctgagaacagccgcagcacccagaggctc
atgctgcccccgcccaccctcaccgcctctggggtcttcgccaaattccgggacatcgcc
cggctcactggcagcgcgtccacagccaagaagatagagatcatcaaaggcctgtttgtt
gcctgccgccattcggaagcccggttcatcgccagagccctgagcggacggctgcgcctc
gggctggcagagcagtcggtgctggccgccctcgcccaggccgtgagcctcacgcccccc
gggcaaggcttccctccagccgtggtggatgccgggaagggcaggacagcagaggccagg
aagacgtggctggaggagcaaggcatgatcctgaagcaaacgttctgcgaggtgcctgac
ctggaccgcgttgtccccgtgctgctggagcacggcctggagcggctcccggagcactgc
aggctgagtccaggggtccccctgaagccaatgttggcccacccgacccggggcgtcggc
gaggtcctgaagcgctttgaggaggcggctttcacctgcgagtacaaatatgatgggcag
agggcacagatccacctcctggaaggcngnnnnnnnnnnnnnnatcaggaagacaatacc
gggaagtaccccgacatcatcagccgcatccccaagatcaaactcccatccgttacgtcc
ttcatcctggacgccgaagctgtggcctgggaccgggagaagaagcagatccagccgttc
caagtgctcaccacccgtaaacgcaaggaggtggacgccgcggagatccaggtgcaggtg
tgtctgtacgcctttgacctcatctacctcaatggagagtccctggtgcgtgggcccctc
tcccgacgccggcagctgctccgggagaacttcatggagacggagggcgagtttgtcttc
gccacctccctggacaccaaggacacggaccagatcgccgagttcctggagcagtcggtg
agagactcctgcgaggggctgatggtgaagaccctggacgtcgacgccacctacgagatc
gccaagaggtcgcacaactggctcaagctgaagaaggactacctggacggcgtgggggac
acactggacctcgtggtgattggcgcctacctgggccggggcaagcgggccggccgctac
gggggcttcctcctggccgcctacgacgaggacagcgaggagctgcaggccatatgcaag
ctgggaaccggcttcagcgacgacgcgctggaggagcatcaccaccgcctgcaggccctg
gtgctgcccagcccgcgctcctacgtgcgggcggacggggccgtggcccccgaccactgg
ctggagcccagcgccgtgtgggaagtcaagtgcgccgacctctctctgtcccccatctac
cccgccgcccgcggcctggtggacagcgagaagggcgtctccctgcgcttccctcggttc
atccgcgtccgtgaagacaagaagccggaggaggccaccaccagtgcccaggtggcctgt
ctgtacaggaagcagagtcaggttcagaaccagcaaggctcacactcggagtccgaccca
gaggatttctactag

DBGET integrated database retrieval system