KEGG   Pteropus alecto (black flying fox): 102888994
Entry
102888994         CDS       T02993                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04071  Sphingolipid signaling pathway
pale04141  Protein processing in endoplasmic reticulum
pale04210  Apoptosis
pale04530  Tight junction
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04722  Neurotrophin signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05022  Pathways of neurodegeneration - multiple diseases
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102888994 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102888994 (MAP3K5)
   04668 TNF signaling pathway
    102888994 (MAP3K5)
   04071 Sphingolipid signaling pathway
    102888994 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102888994 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102888994 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102888994 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    102888994 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102888994 (MAP3K5)
   05012 Parkinson disease
    102888994 (MAP3K5)
   05014 Amyotrophic lateral sclerosis
    102888994 (MAP3K5)
   05016 Huntington disease
    102888994 (MAP3K5)
   05017 Spinocerebellar ataxia
    102888994 (MAP3K5)
   05022 Pathways of neurodegeneration - multiple diseases
    102888994 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102888994 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102888994 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102888994 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102888994 (MAP3K5)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102888994 (MAP3K5)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: STE group
  STE11 family
   102888994 (MAP3K5)
SSDB
Motif
Pfam: DUF4071 Pkinase PK_Tyr_Ser-Thr ASK_PH Pkinase_fungal FPP Kinase-like
Other DBs
NCBI-GeneID: 102888994
NCBI-ProteinID: XP_006915447
LinkDB
Position
Unknown
AA seq 1391 aa
MSAAAGEGITFSVPPFAPSGLCAFPEGSSCRSGEVAAEGEENQLQPPPPGSFWNVESTAA
SGTGCPAATSGSSATRCRGNSGGAGGRRTTVAYVINEASQGQLVVAESEALQSLREACEK
VGAALETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNII
LYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMVTPHNKVYCCDSSFMKGLTELMQPNF
ELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQR
VDNTEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRR
NLPGDRAKALDIMIPLVESEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGAFWFKKA
FESEPTLQSGINYAVLLLAAGYQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFL
GASVLANDHLRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKQTTEQPVAKQELVDFW
MDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDTKGIHEW
NFSAASVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRGQE
EGDCETDSLEYDYEHDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPL
HEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGF
YTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGILKISDFGTSKRLAGINPCTETFTGT
LQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPE
IPESMSAEAKAFISKCFEPDPDKRACANDLLTDEFLKVSSKKKRSQPKLSALSPGSSEYL
RSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGEKDVKGMRTLFLGIPD
ENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKL
KWEHITTLTASLREFVRSTDRKIIASTLSKLKLELDFDSHGISQVQVVLFSFQDAVNKVL
RNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDAEEDHEEQP
ANHIAQRPHAIIEDAVATSGVSTLSSTVSHDSQNANRSLNVQLGRMKIETNRLLEELIQK
EKELQALLLQAIEDKDQEIKHLKLKSQPIDIPGLPVCHLTSSGTNTEDSELIDWLRENGA
DEDTISRFLAEDYSLVDVLYYATRDDLKCLRLRGGMLCTLWKAITNYREKQAEPSLNLFP
TFRGDSKNEHN
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgagcgcggcggcgggcgagggcatcactttctccgtgccaccctttgccccctcgggc
ctctgcgccttccccgagggcagcagctgccggagtggagaagtggcggccgagggtgag
gagaatcagctacaaccgccgccaccgggaagcttctggaatgtggagagtacggccgct
tctggcaccgggtgtcccgctgccacctccgggagcagcgccacccgatgccggggcaac
tctggtggcgcaggcggccgacggactacagtggcatatgtgatcaacgaagcgagccag
gggcagctggtggtggccgagagcgaggccctgcagagcctgcgggaggcgtgcgagaag
gtgggcgccgccctggagaccctgcactttggtaaactggactttggggagaccacagtg
ctggaccgtttttacaatgcagatattgctgtggtggagatgagtgatgccttccggcag
ccgtccttgttttaccaccttggagtaagagaaagtttcagcatggctaacaacatcatc
ctctactgtgacactaactcagactctctacagtcactgaaggaaatcatttgccagaag
aatactatgtgcactggaaactacacgttcgttccatacatggtgactccacataacaag
gtctactgctgtgacagcagcttcatgaaggggttgacagagctcatgcaaccgaacttt
gagctgcttcttggacccatctgcttacctctcgtagatcgtttcattcagcttctgaag
gtggcacaagcaagttccagccagtatttccgggaatctatactcaatgatatccggaaa
gctcgtaatctatacactggtaaagaactggcagctgaattggcaagaattcgtcagcga
gtagataatactgaagtcttgacagcagatattgtcataaatctgttactttcctacagg
gacattcaggattatgattctattgtgaagttggtagagactttagaaaagctgccaacc
tttgatttggcctcccatcatcatgtgaagtttcattatgcatttgcactgaataggaga
aatctccctggagatagagcaaaagctcttgatattatgattccactggtggaaagtgaa
gggcaagttgcttcagatatgtattgcctagttggtcgaatctacaaagatatgtttttg
gattctaatttcacagacactgaaagtagagaccatggagctttttggttcaaaaaggca
tttgaaagtgagccaacactacagtcaggaattaattatgcggtccttctcctggcagct
gggtaccagtttgagtcttcctttgagctccggaaagttggggtgaagcttagtagcctt
cttggtaaaaagggaaacttggaaaaactccagagctactgggaagttggtttttttctg
ggggccagtgttctggccaatgaccacttgagagtcattcaagcatctgaaaagcttttt
aagctgaagacaccagcatggtacctcaagtctattgtagagacaattttgatatataag
cattttgtgaaacagactacagaacaacctgtggccaaacaggaacttgtggacttctgg
atggattttctggtcgaggccacaaagacagatgttactgtagttaggtttccagtctta
atattagagccaaccaaaatctatcagccttcatatttatctatcaacaatgaagttgag
gaaaagacaatatctatttggcatgtgcttcctgatgacacgaaaggtatacatgagtgg
aattttagtgctgcttctgtcaggggagtgagtatttctaaatttgaagaacggtgctgt
tttctttatgtgcttcacaattccgatgatttccaaatctatttctgcacagaacttcac
tgtaaaaagtttttcgaaatggtgaacaccattacagaggagaaggggagaggccaagag
gaaggagactgtgaaactgactccctggagtatgactatgaacatgatgaaaatggtgac
agagttgttttaggaaaaggcacttatgggatagtctacgcaggtcgagacctgagcaac
caagtcagaattgctattaaggaaatcccagagagagatagcagatactcccagccccta
catgaagaaatagcattgcataagcatctgaagcacaaaaatattgtccaatatctgggc
tctttcagtgagaatggtttcattaaaatcttcatggagcaggttccaggaggaagtctt
tctgctctccttcgttccaaatggggcccattgaaagacaatgagcaaacaattggtttt
tatacaaagcaaatacttgaaggattaaaatacctccatgacaatcagatagttcacagg
gatataaagggtgacaatgtgttgattaatacctatagtggtattctcaagatctctgac
ttcgggacatcaaagaggctcgccggcattaacccatgtaccgaaacatttactggtacc
cttcagtatatggcaccagaaataatagataaaggcccaagaggctacgggaaagcagca
gacatttggtctttgggctgcacgatcatcgaaatggccacaggaaaaccacccttttat
gaactgggagaaccacaagccgctatgttcaaggtgggaatgtttaaagtccacccggag
atcccggagtccatgtcagcagaggccaaggcattcatatcgaaatgttttgaaccagac
cctgacaagagagcctgtgctaatgacttgctcactgatgagttcttaaaagtttcaagc
aagaagaaaaggtcgcaacctaagctttcagctctttctcctggatcaagcgaatatctt
aggagcatatccttgccggtacctgtcctggtggaggacacaagcagcagcagtgagtat
ggctccgtttctcccgacacggagttaaaggtggaccccttctctttcaaaacaagagcc
aaatcctgtggagaaaaagatgtgaaaggaatgcggacactctttttgggcattccagat
gaaaattttgaagatcatagcgctccaccttcccctgaggaaaaagactctggttttttt
atgctgaggaaggacagtgaaagacgggccacacttcacaggatcctgacggaagaccaa
gacaaagtcgtgagaaacctaatggaatctttggctcagggggctgaagaacctaaacta
aaatgggaacacatcacaaccctcaccgcaagcctcagagaatttgtaagatccacggac
cgaaaaatcatagccagcacactgtcaaaactgaagttagagctcgacttcgacagccat
ggcattagtcaagtccaggtggtactcttcagttttcaagacgctgtcaataaagtcctt
cggaaccataacattaagccacactggatgtttgccttagacagtatcattcgaaaggcg
gtgcagacagccatcaccattctggttccagaactaaggccacattttagccttgcttct
gagagtgatactgcggatcaagaagacctggatgcagaagaggaccacgaggaacagcct
gcaaatcacattgcccaaagacctcacgccatcattgaagatgctgtggctacctcaggg
gtgagcacgctcagttctactgtatcccatgattcccagaatgctaaccgatcactgaat
gtacagctcggaaggatgaaaatagaaacgaatagattactggaagaattgattcagaaa
gagaaagaattacaagcactccttcttcaagctattgaagataaagaccaagaaattaaa
cacctaaagcttaagtctcaaccaatagatattcctggattgcctgtgtgtcacttaact
tcttctggcacaaatactgaagattctgaacttattgactggcttagagaaaatggagct
gatgaagacactataagtcggtttttggctgaggattattcactagtggatgttctctac
tatgctacacgtgatgacttaaaatgcctgagactaaggggagggatgctgtgcacactg
tggaaggccatcacgaactatcgagagaaacaggctgaaccgtcgcttaatttgtttcca
accttccgtggagattctaaaaatgaacacaactga

DBGET integrated database retrieval system