KEGG   Pteropus alecto (black flying fox): 102889101
Entry
102889101         CDS       T02993                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04218  Cellular senescence
pale04714  Thermogenesis
pale04910  Insulin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05168  Herpes simplex virus 1 infection
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102889101 (RHEB)
   04151 PI3K-Akt signaling pathway
    102889101 (RHEB)
   04152 AMPK signaling pathway
    102889101 (RHEB)
   04150 mTOR signaling pathway
    102889101 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102889101 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    102889101 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889101 (RHEB)
   04919 Thyroid hormone signaling pathway
    102889101 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    102889101 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    102889101 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102889101 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102889101 (RHEB)
   05163 Human cytomegalovirus infection
    102889101 (RHEB)
   05165 Human papillomavirus infection
    102889101 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pale04031]
    102889101 (RHEB)
GTP-binding proteins [BR:pale04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    102889101 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase
Other DBs
NCBI-GeneID: 102889101
NCBI-ProteinID: XP_024894765
LinkDB
Position
Unknown
AA seq 189 aa
NRRVKFLCLDTPVYTELLLAFTGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYH
LQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIM
LVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAAS
QGKSSCSVM
NT seq 570 nt   +upstreamnt  +downstreamnt
aatcggagggttaaatttttgtgccttgatacgccagtgtatactgaactgttgcttgct
tttacagggaaatcctcattgacgattcagtttgtcgaaggccaatttgtggactcctac
gatccaaccatagagaacactttcacaaaattgatcacagtaaatggacaagaatatcat
cttcaacttgtagacacagctgggcaagatgaatattccatctttcctcagacatactcc
atagatattaatggttacattcttgtgtattctgttacatcaatcaaaagtttcgaagtg
attaaagttatccacggcaaattgttggacatggtggggaaagtgcaaatacctattatg
ttggttggcaataagaaagacctacatatggaaagggtgatcagttatgaagaagggaag
gcgttagcagaatcttggaatgcagcttttttggaatcttctgctaaagaaaatcagacc
gctgttgatgtttttagaaggataattttggaggcagaaaaaattgatggggccgcttca
caaggaaagtcttcctgctcagtgatgtaa

DBGET integrated database retrieval system