Pteropus alecto (black flying fox): 102889101 Help Entry 102889101         CDS       T02993                                  Gene name RHEB Definition (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pale  Pteropus alecto (black flying fox) Pathway pale04072   Phospholipase D signaling pathway pale04140   Autophagy - animal pale04150   mTOR signaling pathway pale04151   PI3K-Akt signaling pathway pale04152   AMPK signaling pathway pale04211   Longevity regulating pathway pale04218   Cellular senescence pale04714   Thermogenesis pale04910   Insulin signaling pathway pale04919   Thyroid hormone signaling pathway pale05163   Human cytomegalovirus infection pale05165   Human papillomavirus infection pale05168   Herpes simplex virus 1 infection pale05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102889101 (RHEB)    04151 PI3K-Akt signaling pathway     102889101 (RHEB)    04152 AMPK signaling pathway     102889101 (RHEB)    04150 mTOR signaling pathway     102889101 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102889101 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102889101 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102889101 (RHEB)    04919 Thyroid hormone signaling pathway     102889101 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102889101 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102889101 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102889101 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102889101 (RHEB)    05163 Human cytomegalovirus infection     102889101 (RHEB)    05165 Human papillomavirus infection     102889101 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pale04031]     102889101 (RHEB) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102889101 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase Motif Other DBs NCBI-GeneID:  102889101 NCBI-ProteinID:  XP_024894765 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search NRRVKFLCLDTPVYTELLLAFTGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYH LQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIM LVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAAS QGKSSCSVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt aatcggagggttaaatttttgtgccttgatacgccagtgtatactgaactgttgcttgct tttacagggaaatcctcattgacgattcagtttgtcgaaggccaatttgtggactcctac gatccaaccatagagaacactttcacaaaattgatcacagtaaatggacaagaatatcat cttcaacttgtagacacagctgggcaagatgaatattccatctttcctcagacatactcc atagatattaatggttacattcttgtgtattctgttacatcaatcaaaagtttcgaagtg attaaagttatccacggcaaattgttggacatggtggggaaagtgcaaatacctattatg ttggttggcaataagaaagacctacatatggaaagggtgatcagttatgaagaagggaag gcgttagcagaatcttggaatgcagcttttttggaatcttctgctaaagaaaatcagacc gctgttgatgtttttagaaggataattttggaggcagaaaaaattgatggggccgcttca caaggaaagtcttcctgctcagtgatgtaa

DBGET integrated database retrieval system