KEGG   Pteropus alecto (black flying fox): 102889219
Entry
102889219         CDS       T02993                                 

Gene name
PTPN11
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04014  Ras signaling pathway
pale04072  Phospholipase D signaling pathway
pale04360  Axon guidance
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04931  Insulin resistance
pale05168  Herpes simplex virus 1 infection
pale05205  Proteoglycans in cancer
pale05211  Renal cell carcinoma
pale05220  Chronic myeloid leukemia
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102889219 (PTPN11)
   04630 JAK-STAT signaling pathway
    102889219 (PTPN11)
   04072 Phospholipase D signaling pathway
    102889219 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102889219 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    102889219 (PTPN11)
   04670 Leukocyte transendothelial migration
    102889219 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102889219 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102889219 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    102889219 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102889219 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102889219 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102889219 (PTPN11)
   05211 Renal cell carcinoma
    102889219 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102889219 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102889219 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102889219 (PTPN11)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102889219 (PTPN11)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102889219 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 102889219
NCBI-ProteinID: XP_024900245
LinkDB
Position
Unknown
AA seq 591 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVXXXXXXXXXX
XXXXXNIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVER
GKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRT
WPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIREK
GVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEY
TNIKYSLTDQTGGDQSPLPPCTPTPSCPEMREDNARVYENVGLMQQQKSFR
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggcgtggaggccgaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcccagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacttgtatggaggggagaagtttgccactttggctgagttggttcagtat
tacatggaacatcacgggcaattgaaagagaagaatggagacgtcattgagctcaagtat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgagaaaggaaaacacggtagctttctggtacgagagagc
cagagccaccctggagattttgttctctctgtccgaaccggtgacgacaagggggagagc
aatgacggcaagtctaaagtgactcacgtcatgatccgctgtcaggaactgaaatatgac
gtcggtggaggagagcggtttgactctttgacagatctcgtggagcattacaagaagaac
cccatggtagaaactttgggcacagtactgcaactcaagcagcccctcaacacgactcgt
atcaatgctgctgaaatagaaagccgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacagcaggagtgcaaa
cttctctacagccgaaaagagggtcagaggcaagaaaataaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnaaatattatcatgcctgaatttgaaaccaaatgcaacaattccaag
cccaaaaagagttatattgccacacaaggctgtctgcaaaatacggtgaatgacttttgg
cggatggtgtttcaagagaactcccgagtgattgtcatgacaacgaaagaagtggagaga
ggaaagagtaaatgtgtcaaatactggcccgacgagtacgctctaaaagaatacggcgtc
atgcgcgttaggaacgtcaaagaaagtgccgctcatgactatacgttaagagaacttaaa
ctttccaaggtcggacaagggaatacggagagaacggtctggcaataccactttcggacc
tggccggaccacggagtgcccagtgaccccgggggcgtgctggacttcctggaggaagtc
caccataagcaggagagcatcgtggacgcggggcctgtggtggttcactgcagtgctgga
attggccggacagggacatttattgtgatcgatatccttattgacatcatcagagagaaa
ggcgttgactgtgacatcgacgttcccaaaacaattcagatggtgcggtctcagaggtca
gggatggtccagacagaagcacagtaccgattcatctatatggccgtccagcattatatc
gaaacactacagcgtagaattgaagaagagcagaaaagcaagaggaaagggcacgaatat
acaaatattaagtattctctaacggaccagacaggtggggatcagagtccactcccgcct
tgtaccccgacgccgtcctgtccagaaatgcgagaagataatgctagagtctatgaaaac
gtgggtctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system