KEGG   Pteropus alecto (black flying fox): 102889339
Entry
102889339         CDS       T02993                                 

Gene name
ATR
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03460  Fanconi anemia pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04218  Cellular senescence
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102889339 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102889339 (ATR)
   04115 p53 signaling pathway
    102889339 (ATR)
   04218 Cellular senescence
    102889339 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889339 (ATR)
   05170 Human immunodeficiency virus 1 infection
    102889339 (ATR)
   05165 Human papillomavirus infection
    102889339 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102889339 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102889339 (ATR)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102889339 (ATR)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102889339 (ATR)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102889339 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2 Bromo_TP
Other DBs
NCBI-GeneID: 102889339
NCBI-ProteinID: XP_015449232
LinkDB
Position
Unknown
AA seq 2634 aa
MGEHGLELASMIPALRELGSASPEDYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSHGQNEAKASCIDFSNWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKSPAIFGVLTKELLHLFEDLIYLHRRNAMGQFVEWPVVVSR
FLSQLNEHVGYLQPAPLQFMNMENLEFIEVTLLTVLIRIIAIVFFRRQELLLWRIGCVLL
ECGSPKIKALAISLLTELFELGGLPALPASTFFSSFLELLKHIVEMDADQLKLYEEPLSK
LIKTLFPFEAESYRNIEPVYLNMLLEKLCVMFENGVLMRLKSNLLKAALCHLLQYFLKYV
PAGYESALQVRKVYVRNICRALVDVLGVQVETEYLLGPLYAALKMESMEIIEEVQCQIQE
ENLSGNSDGISPKRRRLSSSLNSSKRAPKLTEEIKHVDMNNKSILWSALKQKAESLQIFL
EYSSLKNSVIETLEGIAVVLQLTALCTVHCSHQNMDCHNFEDYQQKCKKKPSIMITWMSL
DFYTKMLKSCRSLLESVQKPDLETIIDKVIKIYDALIYIQVKTSFEDHILENLCGMLSLP
WIYSHSDDDSLKLTTFATNLLTLSQRISDSFSPQAQSRCVFLLTLLPRRIFFEWRTSVYS
WALQSSHEVIRASCVNGFFILLQKQNSCLRVPKILIDKVKDDSDIVKKEFASILGQLVCT
LHGMFYLTSSLTEPFSEHGHTDLFCKSLKVTSQYECSSSLLKASVFKPLLFLLKKKTPSP
VKLAFLGNLYHLCKHLDFREDETDVKTVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDS
EDGFIKELFVLRMKEAYTRAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLL
SKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPNTPCQNA
EMRKQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTL
GKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHN
ELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQ
LLSSSVGIEDKKMALNSLISLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWD
CFVRCLDHACLGSLLSHVIVALLPLIHIQPKETAAMFHYLIIENRYAVQDFLHEIYFLPD
HPELKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEK
LIKYATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQ
GKDFTFVTGVEDSNFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREIQIDS
PGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFAEWSASWAGY
LITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQDDQQEVYAEIMAVLK
HDDQHTISTQDSASDLCQLSTQTVFSMLDHLTQWARHNXSKSHRDKVDSMVSTVDYEDYQ
SVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQDIQEHLGFLQKLYAAMHEPD
GVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLG
QLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLGQL
LLSAKKRDIAAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCELEHSIKPL
FHKSPDDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSVNKRPDYNEMVGECWLQS
ARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFPEN
KTPTESKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTLFLPEWEDGHFYLAKYYD
KLMPMVTDNKMEKQGDLIRYILLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWEKA
ARSDRVQMRNDLAKINKVITEHTNHLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKV
FLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTDKLLELCN
KPVDGSSCTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSIPGTHANHDPFPGHW
AYISSFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLR
KDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQCM
LPKAAALSEKLKVFREFLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYI
LGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEG
LFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKT
HVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
NT seq 7905 nt   +upstreamnt  +downstreamnt
atgggcgagcacggcctggagctggcgtctatgatccccgccctgcgggagctgggcagt
gccagtccagaggactataatacagttgtacagaagccaagacaaattctttgtcaattt
attgaccgaatactaacagatgtaaatgttgttgctctagaacttgtaaagaaaactgac
tctcagccaacctctgtgatgttgcttgatttcatccagcatatcatgaagtcctcccca
ctcatgtttgtaaatgtgaatggaagccatgggcaaaatgaggccaaagccagttgtatt
gacttcagtaattggatcataacaagacttctgcgaattgcagcaactccatcctgtcat
atgttacacaagaaaatctgtgaagtcatctgctcattattatttctttttaaaagcaag
agtcctgctatttttggagtactgacaaaggaattattacatctttttgaagacttgatt
tacctccatagaagaaatgcaatgggacagtttgtggaatggccagtggtagttagccga
tttttaagtcaactaaatgaacatgtgggatatttacaaccagctcctttgcagttcatg
aatatggaaaatttagaatttattgaagtcactttattaacagttctcattcgtattatt
gcaattgtgttttttagaaggcaagagctcttactttggcggataggttgtgttctgctg
gagtgtggtagtccaaaaattaaagccttagcaattagtcttttaactgaactctttgag
cttggaggactaccagcactaccagccagcacttttttcagctcatttttggaattatta
aaacacattgtagaaatggatgctgaccaattgaagctctatgaagagccattatcaaag
ctgataaagactctgttcccctttgaagcagaatcttatagaaatattgagcctgtatat
ttaaatatgctgctggaaaagctctgtgtcatgtttgaaaatggtgtgcttatgcggctt
aagtccaacttgctaaaagcagctttgtgccacttactgcagtatttccttaaatatgtg
ccagctgggtatgaatctgctttacaagtcagaaaggtttatgtgagaaatatttgtaga
gctcttgtggatgtgcttggagttcaggtagaaacagagtatttgttgggcccactttat
gcagccctaaaaatggaaagtatggaaataattgaggaggttcagtgccaaattcaagag
gaaaacctcagtggtaatagtgatggaatatcacccaaaaggcgtcgactcagctcatct
ttaaactcttccaaaagagcaccaaaactgactgaggaaattaaacatgtggatatgaac
aacaagagcatattatggagtgcgctgaaacagaaagctgaatcccttcagattttcctt
gaatacagtagtctaaagaattctgttattgagactttagaaggaattgctgttgtccta
cagctgactgctttgtgtactgttcattgttctcatcaaaacatggactgccataatttc
gaggactatcaacagaaatgtaaaaagaaaccttcaataatgataacttggatgtctttg
gatttttacacaaaaatgcttaagagctgtagaagtttgttagaatctgttcagaaacct
gacctggagacaattattgataaagtgataaaaatatatgatgctttgatttatattcaa
gttaaaacttcatttgaagatcatattctggaaaatttatgtggaatgctctcacttcca
tggatttattcccattctgatgatgactctttaaagttgaccacatttgccactaatctg
ctaacattaagccagaggatttcagatagcttctcaccgcaggcacaatcacgatgtgtg
tttcttctaactctgttaccaagaagaatattctttgaatggagaacgtcagtttacagc
tgggccctgcagagctcccatgaagtaatccgagctagttgtgttaatggattttttatc
ttattgcagaaacagaactcttgtctcagagttcccaagattcttatagataaagtcaaa
gatgattctgacattgtcaagaaagaatttgcttctatacttggtcaacttgtctgtacg
cttcatggcatgttttatttgacaagttctttaacagaacctttttctgaacatggacat
accgacctcttctgtaagagcctaaaagtcacttctcaatacgaatgttcatcttctcta
ctaaaagcttctgttttcaaaccattacttttcttattgaaaaaaaaaacacctagtcca
gtgaaacttgcttttttaggtaatctgtatcatctttgtaagcatcttgattttagagaa
gatgaaacagatgtaaaaacagttcttggaactttattaaatttaatggaagatccagac
aaggatgttagagtggcttttagtggaaatatcaagcatatattggaatccttggactct
gaagatggatttataaaagagctttttgtcttaagaatgaaggaagcatatacacgtgct
caaatctcaagaaataatgagttgaaggataccttgattcttacaacaggggatattgga
agggcagcaaaaggagatttagtaccatttgcactcttgcacttattgcattgtttacta
tccaagtcagcatctgtctctggagcagcatacacagaaattagagctctggttgcagct
aaaagtgttaagctgcaaaattttttcagccagtataagaaacccatctgtcagtttttg
gtggaatccctccactccagtcagatgacagcacttcctaatactccgtgccagaatgct
gagatgcgaaaacaagatgtggctcaccagagagaaatggctttaaataccttgtctgaa
attgccaatgtttttgactttcctgatcttaatcgtttccttactaggaccttacaagtt
ctgctacctgatcttgctgccaaagcaagccctgcagcttctgctctcattcgaacttta
ggaaaacaattaaatgtcaatcgtagagagattttaataaataacttcaaatatattttt
tctcacttggtatgttcctgttccaaggatgaattagaacgtgcccttcattatctgaag
aatgaaacagaaattgaactggggagcctgttgagacaagatttccaaggattgcataat
gagttattgctacgtattggagaacactatcaacaggttttcaatggtttgtcaatactt
gcctcatttgcatctagtgatgatccatatcagggcccaagagatatcatatcacctgaa
ctaatggctgattatttacaacccaagttgttgggcattttggccttttttaacatgcag
ttacttagctccagtgttggcattgaagataagaaaatggccttgaacagtttgatatcc
ttgatgaaactgatgggacccaaacatgtcagttctgtgagagtgaagatgatgaccaca
ttgagaactggccttcgattcaaggatgattttcctgaattgtgttgcagagcttgggat
tgctttgttcgttgcctggatcatgcttgtctaggctcccttctcagtcatgtaatagta
gctttattacctctcatacacatccagcctaaagaaactgcggccatgtttcactacctc
ataattgaaaacaggtatgctgtacaagattttcttcatgaaatatattttttgcctgat
catccagaattaaagaagataaaagcagttctacaggaatacagaaaggaaacctctgag
agtaccgatcttcagacaactcttcagctatccatgaaagcaattcagcatgaaaatgta
gatgttcgtattcatgctcttacaagcttgaaggaaaccttgtataaaaatcaggaaaaa
ctgataaaatatgcaacagatagtgaaacagtggaacctgttatctcacagttggtgaca
gtgcttttgaaaggttgccaagatgcaaactctcaagctcggttgctctgtggggaatgt
ttaggggaattgggggcaatagatccaggtcgactagatttctcaacaactgaaacccaa
ggaaaagattttacatttgtgactggagtagaagattcaaactttgcctatggattattg
atggaactaacaagagcttaccttgcatatgcagataatagccgagctcaagattcagct
gcttatgccattcaggagttactttctatttatgactgtagagagatacagattgacagc
ccaggtcaccaattgtggaggagatttcctgagcatgttcgggaaatactggaacctcat
ctaaatactagatacaagagttctcagaagtcaacagattggtctggagtaaagaagcca
atttacttaagtaaattaggtaataactttgcagaatggtcagcatcttgggcaggttat
cttataacaaaggttcggcatgatcttgccagtaaaatcttcacctgctgtagcattatg
atgaagcatgatttcaaggtgaccatctatcttcttccacatattcttgtgtatgtcttg
ctgggttgtaatcaagatgatcagcaggaggtttatgcagaaattatggcagttctaaag
catgatgatcagcataccataagtacccaagacagtgcatctgatttgtgtcaactcagt
acacagactgtattctccatgcttgaccatctcacacaatgggcaaggcacaatnnaagc
aaatcacacagagataaggtagactcaatggtatctactgtggattatgaagactatcag
agtgtaactcgtttcctagacctcatacctcaggatactctggcagtagcttcctttcgc
tccaaagcctacacacgagctgtaatgcactttgaatcatttattacagaaaagaagcaa
gatattcaagagcatcttggatttttacagaaattatatgctgctatgcatgaaccagat
ggagtggctggagtaagtgcaattcgaaaggcagaaccatctcttaaagaacagatcctt
gaacatgaaagcattggcttactgagagatgccacagcttgttatgacagggctattcag
ctagaaccagaccagatcattcattatcatggtgtagtgaagtccatgttgggtcttggt
cagctctctactgtaatcactcaggttaatggagttcatgctaacaggtctgaatggaca
gatgaattaaacacatacagagtggaagcagcttggaaattgtcacagtgggatttggtg
gaaaactatttggcagcagatgggaaatctacaacatggagtgtcagactgggacagctg
ttattatcagccaaaaaaagagatatcgcagctttttatgacacactgaaactagtgaga
gcagaacaaattgtacctctttcggctgcaagctttgaaagaggctcttaccaacgagga
tatgaatatattgtgagattgcacatgttgtgtgagttggagcatagcatcaaaccactt
tttcacaagtctccagatgacagttctcaagaagattctctaaactgggtagctcgacta
gaaatgacccagaattcctacagagctaaggagcccattctggctcttcggagagcttta
ttaagcgtcaataaaagaccagattataatgaaatggttggagaatgctggctacagagt
gccagagtagctagaaaggctggtcaccaccagacagcctacaatgctctccttaatgct
ggagagtcacgacttgctgaactgtatgtggaaagggcaaagtggctatggtccaagggt
gatgttcaccaggcactaattgttcttcaaaagggtgttgagttatgttttcctgaaaat
aaaaccccaactgagagtaagaacatgttaatccatggtcgagctatgctactagtaggc
cgatttatggaagaaacagctaactttgaaagcaatgcaattatgaaaaaatataaggac
gtgaccttgttcctgccagagtgggaagatgggcatttctaccttgccaagtactatgac
aagttaatgcccatggtcacagacaacaaaatggaaaagcaaggtgatctcattcggtac
atactccttcattttggaagatctctacagtatggaaatcaattcatatatcaatcaatg
ccacggatgttatcactatggcttgattttggtgctaaagcatatgaatgggaaaaagct
gcgcgctctgatcgtgtacaaatgagaaatgatttagctaaaataaacaaagtgatcaca
gagcacacaaatcacttagctccctatcagtttttgactgctttttcacaattgatctcc
cgaatttgccattctcatgatgaagtttttgttgtcttaatggaaattatagccaaagtg
tttctggcctatcctcagcaagcaatgtggatgatgacagctgtgtcaaagtcttcttat
cccatgcgagtgaacagatgcaaggaaatcctaaataaagctattcatatgaaaaaatcc
ttagaaaaatttgttggagatgcaactcgcctaacagataagcttctagaattgtgcaat
aaaccggtggatggaagtagttgcacattaagcatgagcactcattttaaaatgcttaaa
aagctggtagaagaagcaacatttagtgaaatcctcattcctttacaatcagtcatgata
cctactcttccatcaattccgggtacccatgctaaccatgatccatttcctgggcattgg
gcctatatttcaagctttgatgatatggtggaaattcttgcttctcttcagaaaccaaag
aaaatctctttaaaaggatcagatggaaagttctacatcatgatgtgtaagccaaaagat
gacctgagaaaggactgtagactaatggaattcaattccttgattaataagtgcttaaga
aaagatgcagaatctcgtagacgagaacttcatatccgaacatatgcagttattccactg
aatgatgaatgtgggattattgaatgggttaataacactgctggcttgagacctattctg
accaaactatacaaggaaaaaggagtttatatgacaggaaaggaacttcgccaatgtatg
ctaccaaaggcagcagctttgtctgaaaaactcaaagtattccgagaatttctcctaccc
aggcatcctcctgtttttcatgagtggtttctgagaacattccctgatcctacatcatgg
tacagtagtagatcagcatactgccgttccactgcagttatgtcaatggttggttatatc
ctgggccttggagaccgtcatggtgaaaacattctctttgattctttgaccggtgaatgt
gtacatgtggatttcaactgtctcttcaataagggagaaacctttgaagttccagaaatt
gttccatttcgcctgactcataatatggttaatggaatgggtcctatgggaacagaaggc
ctttttcgaagagcttgtgaagttacaatgaggctgatgcgagatcagagagagccttta
atgagtgtcttaaagacttttttacatgatcctcttgtggaatggagtaaaccagtaaaa
gggcattccaaagcaccactgaatgaaaccggggaagttgtcaacgaaaaggccaagacc
catgttcttgacatcgagcagcgactgcaaggtgtaatcaagacccgaaatagagtgaca
ggcctgccattatctattgaaggacatgtgcattaccttatacaagaagctactgacgaa
aacttactatgccaaatgtatcttggatggaccccatatatgtga

KEGG   Pteropus alecto (black flying fox): 102898588
Entry
102898588         CDS       T02993                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03440  Homologous recombination
pale04064  NF-kappa B signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
pale05202  Transcriptional misregulation in cancer
pale05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102898588 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102898588 (ATM)
   04068 FoxO signaling pathway
    102898588 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102898588 (ATM)
   04210 Apoptosis
    102898588 (ATM)
   04115 p53 signaling pathway
    102898588 (ATM)
   04218 Cellular senescence
    102898588 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102898588 (ATM)
   05206 MicroRNAs in cancer
    102898588 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898588 (ATM)
   05170 Human immunodeficiency virus 1 infection
    102898588 (ATM)
   05165 Human papillomavirus infection
    102898588 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102898588 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102898588 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102898588 (ATM)
   03400 DNA repair and recombination proteins [BR:pale03400]
    102898588 (ATM)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102898588 (ATM)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102898588 (ATM)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102898588 (ATM)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102898588 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 102898588
NCBI-ProteinID: XP_006913492
LinkDB
Position
Unknown
AA seq 3057 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKCLIRDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKHIQKETECLKTARPNVSSSAQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSDGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
DINRVLLARIIQAVTKGCCSQTDGLNPKFLDFFSKAIQNARQEKIFAGLNHILAAFIIFL
KTLAVNFRIQVCELGDENLPTLVYIWTQHRLNDSLKEIIIELFQLQIYIHHPKGAKTQEK
GAYESRKWRSILYDLYDLLVNEINHIGSRGKYSSVFRSIAVKENLIELMADICHQVFNED
TRSLEISQSYTITQREFNAYSVPCKKRKIELGWDVIKDHLQKSQNDFELVPWLQITTQLI
SKYPANLPNCELSPLLMILHQLLPQQRRGERTPYVLRCLMEVALCQSKKSDLESSQKSDL
LKLWIKIWSITFRRISSEQIQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLMLALTICVVPETVKMGMEQNICEVNRSLSLKELIMKWLLFYQLEDDFEDRTELPPTLH
SDFPHLVLEKILVSLTMKNCKDAMNFFQSVPECEQHQKDKEEPSFSAVEELFLRTTFDKM
DFLTVAKDCVVEKHQSSICFSVHQNLKESLDRYLLGLSEQLLNNYSYETTNTGTLVRCSS
LLVGVLGCYCFVGVITEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEESRIVSLREMM
HLCTRCLCNCTKHNPNKIASGFFLRLLTSKLVNDIADICRSLSSFIKKPLDYKEVESMED
NTNENLMEMENQSSMSVCSDFPASSVSDANESGESQLTIGAMSPLAEEHLSKQDLLLLDM
VRFLCMCVTTALTNTVSFRAADIRRKLLMLIDSSILDPTKPLHLHMYLVLLKELPREEYP
LPMEDVAELLKPLSNVCSLYRRDQDVCKTILNHVLHIVTNLCQGNIDAENTKDAQGQFLT
VIGAFWHLTKEGKCTFSVRMALVKCLKTLLEADPYSKWAVLSVMGKDFPVNEVFPQFLAD
NDHQVCMLAAESINRLFQDVKQASSSTLSKALPLKLQQTAFENAYLKAQEGMREVSHRAE
NPELLDEIYNRKAVLLMTIAVVLYSSPVCEKQALFALCKSVKENGLEPHLIKKVLEKVSA
TFGYSHLEDFMASHLDYLVLEWLNLQDTEYSLSSFPFVLLNYANVEDFYRSCYKVLIPHL
VIRSNFDEVKSIANQIQEDWKHLLTDCFPKILVNILPYFAYEGTGDVGMGQQRETATKVY
DMLKDENFLGKQIDHLFVANLPEIVVELLMTLHEPATSGTSQSTDLCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKFKSILEILSKSPDSYQKILLAICEQAAETNNIYKKHRIL
TIYHLFVSLLLKDIKTGLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLS
RVCHTAVTYSKDALENHLHVIVGTLIPLVDNQMEVQEQVLDLLKYLVIDNKDNENLYITI
KLLDPFPDRVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVCDALPLTRLEGLKDLRR
QLEQHKDQMVELMRASQGNPQDGIMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVG
PIDFSTIAIQHSKDISYAKALELFEDKELQWTLIMLTFLNNTLTEDCVKVRSAAVTCLKN
ILATKTGHSFWEIYKTTADPMLIYLQPFRTSRKKFLEVPRLDKESLLEGLDDSSLWIPQS
ENHDVWIKTLTCAILDSGGTKSEILQLLKPMCEVKTDFCQAVLPYLIHDILLQDTNESWK
NLLSTHIQGFFSNCFRHSSQTSRSTTPANLDSESEHFSRCYLDKKSQRTMLAVVDYMRRQ
KRSSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNMDDQEKRNLMFEEG
SQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHEA
MWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDHENKEWGAELQELHY
QAAWRNMQWDHCISVDKQVEGTSYHKSLYNALQSLRDREFSTFYESLKYARVKEVEELCK
GSLESVYSLYPTLSRLQAIGELESIGELFSRSITDKQPSEVYIKWQKHSQLLKDTDFSFQ
EPIMALRTVILEILMEKEMENSQRECFKDILTKHLVELSILARTFKNTQLPERAIFQIKQ
YNSTSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCSENDPKLKLIYTECLRV
CGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGENNNELRNGKMKAFLSLARFSDTQYQR
IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNDRYIMKVQRELELDECALRALKEDR
KRFLCKAVENYINCLLSGEEHDMWIFRLCSLWLENSGVSEVNGMMKRDATKIPSYKFLPL
MYQLAARMGTKMMGGLGFHEILNNLISKISTDHPHHTLFIILALANANKDEFLTIPEAAR
RSRLTKNAPKQNSQLDEDRIEAANKIIRTIRSRRPQMVRSIEALCDAYIMLANLDATQWK
AQRKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYENLVTIQSFKAEFRLAGGINLP
KIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTISTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSAYQCQKKMMDVQKKSYEEKYKT
FMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
NSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRLEDETELHSTPNAAHRECKRNLSDTD
QSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactggaacatgatagagct
accgaacgaaggaaagaagttgagaaatttaagtgcctgattcgggatcctgaaactgtt
caacatttagatcggcattcagattccaagcaagggaaatatttgaattgggatgctgtt
tttagatttttacagaaacatattcagaaagaaaccgaatgtctgaagacagcaagacca
aatgtgtcatcctcagcacaagccaccaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaatacttcatcaaatgtgcaaataaaagagcacccaggctaaaatgtcaagaactc
ttgaattacatcatggatacagtgaaagattcatctgatggtgccatttatggagctgat
tgtagcaacatactgctcaaagacattctttcagtgagaaaatactggtgtgaaatatct
cagcaacagtggctagaattattctctgtgtacttcaggctgtatcttaaaccttctcaa
gacattaatagagttttactggctagaataattcaagctgtgactaaaggatgctgctca
caaactgatggattgaatcccaaatttttggattttttttccaaggctattcaaaatgca
agacaagaaaagatctttgcaggtctaaatcatatcttagcggcatttattatcttcctc
aagactttagctgttaattttcgaattcaagtgtgtgaattaggagatgaaaatcttcct
actttggtttatatttggactcaacacagacttaatgattctttaaaagaaataattatt
gaattatttcagctgcaaatttatatccatcatccaaagggagccaaaacccaagaaaaa
ggtgcttatgaatcaagaaaatggagaagtatcttatacgacttatatgatctgctagtt
aatgagataaatcatatagggagcagaggaaaatattcttcagtatttcgtagtattgct
gtcaaggaaaacttgattgaattgatggcagatatctgtcaccaggtttttaatgaagat
accagatctttggagatttctcagtcctataccatcacacaaagagaatttaatgcttac
agtgtaccttgcaaaaagaggaaaatagaattaggctgggacgtaataaaagatcatctt
cagaagtcacagaatgattttgaacttgtgccttggttacagattacaacccaattaata
tcaaaatatcctgcaaatttacctaactgtgagctgtcaccattattaatgatactacac
cagcttctacctcaacagcgacgtggggaacgcacaccatatgtgttacgatgccttatg
gaagttgctctgtgtcaaagcaagaaatcagatctcgaaagctcacaaaagtcagattta
ttgaaactctggattaaaatttggtctattacctttcgcaggataagttctgaacaaata
caagctgaaaactttggcttacttggagccataattcaagggagtttagttgaagttgac
agagaattctggaagttatttactggatcagcctgtagaccttcatgtcctgcagtatgc
tgtttgatgttggcactgaccatctgtgtggttccagaaacagtaaaaatgggaatggag
cagaatatatgtgaagtaaatagaagtctttctttaaaagaattaataatgaaatggctc
ttattctatcagttagaggatgactttgaagacaggacagagctgcctccaactcttcac
agtgattttcctcatcttgtactggagaaaatccttgtgagtctcactatgaaaaactgt
aaagatgcaatgaattttttccagagtgtgccagaatgtgaacaacaccaaaaagataaa
gaagagccttcattctcagcagttgaagaattatttcttcggacaacttttgacaagatg
gattttttaaccgttgcgaaagactgtgttgtagaaaagcaccaatccagtatatgcttt
tctgtccaccaaaatctcaaggaatcactggatcgctatcttctggggttgtcagaacag
cttctaaataactactcgtatgagactacaaatacaggaacgcttgttcggtgttcaagt
cttttggtgggtgttcttggttgctattgtttcgtgggtgtaataactgaagaggaagca
tataaatcagaattattccagaaagctaagtctctaatgcagtgtgcaggagaaagtatc
actctgtttaaaaataagacaaatgaggaatctagaattgtttccttgagagaaatgatg
catctatgtacaaggtgcttatgtaactgtaccaagcacaatccaaacaaaattgcatct
ggctttttcctacgattgttaacatcaaagctagtgaatgatattgcagatatttgtaga
agtttatcatcttttatcaaaaagccacttgactataaagaagtagaatcaatggaagat
aacactaatgaaaatctaatggagatggagaatcagtcatccatgagtgtatgtagtgat
ttccctgctagtagtgttagtgatgcaaatgaatctggagagagccagcttactatcggg
gccatgagtcctttagctgaagaacatctgtcaaagcaagatctacttcttttggatatg
gtcaggttcctgtgcatgtgtgtaactacggctcttaccaatactgtgtcatttagagca
gctgatattcggaggaaattgttaatgttaattgattctagcattctagaccctactaaa
ccgctacacctacacatgtatctagtgcttttaaaggagcttcctagagaagaatatcct
ttgccaatggaagatgttgctgaacttctaaaaccactatccaatgtatgttctttgtat
cgccgtgaccaagatgtttgtaaaacaattttaaaccatgtccttcatatagtgacgaac
ctatgtcaaggcaatatagatgctgagaacacaaaagatgctcaaggacagtttctaaca
gtgattggagcattttggcacttaacaaaagaggggaagtgcacattttctgtaagaatg
gcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgggctgtt
cttagtgtaatgggaaaagactttcctgtaaatgaagtttttccacaatttcttgctgat
aatgatcaccaagtttgcatgttggctgcagaatcaatcaatagattatttcaggatgta
aaacaagcaagttcttccacattatcgaaagcacttcctttgaagcttcaacaaacagct
tttgaaaacgcatacttgaaagctcaggaaggaatgagagaagtgtcccacagagctgag
aatcctgaacttttggatgagatttataatagaaaagctgttttactgatgacgatagca
gtggttttatactctagccctgtctgtgaaaaacaggctttgtttgccctatgcaagtct
gtgaaagaaaatggattagaacctcacctcattaaaaaggttttagagaaagtttctgca
acttttggatatagtcatttagaggacttcatggcttctcatttggattatctggttttg
gaatggctaaatcttcaagatactgaatatagcttatcttcttttccttttgttttatta
aactatgcaaacgttgaggatttctatagatcttgttataaagttttgattccacatctg
gtaattagaagtaattttgatgaagtgaaatccattgctaatcaaattcaagaagactgg
aaacatcttctaacagactgctttccaaagattcttgtaaatattcttccttactttgcc
tatgagggtacaggagacgttgggatgggacagcaaagagagactgctaccaaagtctat
gatatgctaaaagatgaaaacttcctaggaaaacagattgatcatttatttgttgctaat
ttaccagagattgtggtggagttactgatgacattacatgaaccggcaacttctggtacc
agccaaagcactgacctctgtgatttttcaggggatttggatcctgctcctaatccacct
cattttccatcacatgtgattaaagcaacatttgcctatatcagcaattgccataaaacc
aagtttaaaagcattttagaaattctttccaaaagccctgattcatatcagaaaattctt
ctagccatatgtgagcaagcagctgagacaaataacatttataaaaagcacagaattctt
acaatatatcacctatttgttagtttattattgaaagatataaaaactggcttaggagga
gcttgggcctttgttcttcgagatgttatttatactttgattcactatattaacaaaagg
ccttctcgtttcatggatgtatcattacgtagcttctccctttgttgtgacctattaagc
cgggtttgccacacagcagtaacttactctaaggatgctttagaaaatcaccttcatgtt
attgttggtacacttataccccttgtggataatcagatggaggttcaggaacaggtattg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatcacgatt
aaacttttagatccttttcctgaccgtgttgtctttaaagatttgcgtattactcagcag
aaaatcaaatatagtagaggacccttttcactcttggaggaaattaaccattttctctca
gtaagtgtttgtgatgcacttccattgacaaggcttgaagggttgaaggatcttcgaaga
caactagaacaacataaagatcaaatggtggaacttatgagagcatctcagggtaacccg
caagatggcataatggtgaagctagttgtcagcttgttgcagttatccaagatggcagta
aaccacactggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggt
cctatagatttctctacaatagctatacagcatagtaaagatatatcttatgccaaggcc
cttgagttatttgaagataaagaacttcagtggaccctcataatgctgactttcctaaat
aatacactgacagaagattgtgtcaaagtgcgatcagctgctgttacctgtttgaaaaac
attttagccacaaagactggacatagtttctgggagatttacaagacaacagctgatccc
atgctcatctatctacagccttttagaacatcgagaaaaaagtttttagaagtacccaga
cttgacaaagaaagccttttggaaggcttggatgattcaagcctgtggattcctcaaagt
gaaaatcatgatgtttggataaaaacactgacttgtgcaattttggatagtggaggcaca
aaaagtgaaattctgcaattattaaagccaatgtgtgaggtgaaaactgacttttgtcag
gctgtgcttccatacttgattcatgatattttacttcaagatacaaatgaatcatggaaa
aatttgctttctacacacattcagggatttttcagtaactgtttcagacactcctcacaa
acgagccgatccacaacccctgcaaatttggattcagagtcagagcacttttcccgatgt
tatttggataaaaaatcgcaaagaacaatgcttgctgttgtggactacatgaggagacaa
aagagatcttctggcacagtgttcgatgacgctttctggctggagttgaattatctagag
gttgccaaggtagctcagtcttgtgctgctcactttacagcattgctctatgcagaaatc
tacgcagataagaaaaacatggatgatcaagagaaaagaaatcttatgtttgaagaagga
agccaaagtacaactatttcaagtttgagtgaaaagagtaaagaagaaactggaataagt
ttacaggatctactcttagaaatctacagaagtataggagagccagatagtctgtatggc
tgtggtggagggaaaatgttacaacctcttactagactaagaacatatgaacatgaagca
atgtgggggaaagccctagtaacatatgaccttgaaacagcaatctcttcatcaacgcgc
caggcaggaataattcaggccttgcagaatttgggactctgccatattctttctgtttat
ttaaaaggattagatcatgaaaataaagagtggggtgctgaactacaagagcttcattac
caagcagcatggaggaatatgcaatgggaccactgcatttctgtcgacaaacaagtagaa
ggaaccagttaccacaaatcattgtacaatgctttgcagtctctaagagacagagaattt
tccacattttacgaaagtctcaaatatgccagagtaaaagaagtagaggagttgtgtaag
ggtagccttgagtcggtatattcactctaccctacactcagcagattgcaggccattgga
gagctcgaaagcattggggagcttttctcaagatcaattacagataagcaaccctctgaa
gtatacattaaatggcagaaacactcccagcttctcaaagacaccgattttagttttcag
gagcctatcatggctctacgcacagtcattttggaaatcttaatggaaaaggaaatggag
aactcccaaagagaatgttttaaggacattctcaccaagcaccttgtagaactctccata
ctagcccgaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaacag
tataattcaactagttgcggagtctctgagtggcagctagaagaagcacaagtattctgg
gccaaaaaagaacagagtcttgccctgagtattctcaagcaaatgattaagaagttggat
gcaagttgttcagagaatgatcccaagctaaaacttatatatacagaatgtctgagggtt
tgtggcaactggttagcagaaacttgcttagaaaatcctgcagtcatcatgcagacctat
ctagaaaaggcagtggaagttgctggaaattatgatggagaaaacaataatgagctcaga
aatggaaaaatgaaggcatttctttcattagcgcgattctcagatactcagtaccagaga
attgaaaactacatgaaatcatcagaatttgaaaacaaacaagctctcctgaaaagggcc
aaagaggaagtgggtcttctgcgggaacataaaattcagaccaatgacagatacataatg
aaggttcagcgagagctggagctggatgaatgtgcactccgtgcactgaaagaggatcgt
aaacgtttcttatgtaaagcagttgaaaattacatcaattgcctactaagtggagaagag
catgatatgtggatatttcgcctttgttccctctggcttgaaaattctggggtttctgaa
gtcaatggcatgatgaagagagatgcaacaaagattccatcgtataaatttttgcctctt
atgtaccaactggctgctagaatggggaccaagatgatgggagggctaggatttcatgaa
attctcaataatctcatctccaagatttcaacggatcacccccatcatactttgtttatt
atactagccttagcaaatgcaaacaaagatgaatttttgaccataccagaggcagcaaga
aggagtagactaactaaaaatgcacctaaacaaaattctcagcttgacgaggatcgaatt
gaggctgcaaacaaaataatacgtactatcagaagtagaagacctcagatggtcagaagt
attgaggcactttgtgatgcttacattatgttagcaaatttggatgccactcagtggaag
gctcagagaaaaggcataaatattccagcagaccagccaattactaaacttaagaattta
gaagatgttgttgttcctactatggaaattaaggttgaccccacaggagaatatgaaaat
ctggtgactatacagtcatttaaagcagaatttcgtttagcaggaggcataaatttacca
aaaataatagattgtttgggctccgatggcaaggaaaggagacagcttgtcaagggccgt
gatgacctgaggcaagatgctgtcatgcagcaggttttccagatgtgtaatacattactg
cagagaaacactgagaccaggaagaggaaactgactatctccacatataaggtggttccc
ctttctcagcgaagtggtgttcttgaatggtgcaccggaactgtccctattggtgaattt
cttgttaacaatgagaatggtgcccataaaagatacaggccaaaggatttcagtgcctat
caatgtcaaaagaaaatgatggatgtgcaaaagaagtcttatgaagagaaatataaaacc
ttcatggatatttgccagaattttcaaccagttttccgttacttctgcatggaaaaattc
ttggatccagctgtttggtttgagaaacgattggcctatactcgcagtgtggctacttct
tctattgttggttacatacttggacttggtgatagacatgtacagaatatcttgataaat
gaacagtcagcagaacttgtacatatagatttaggagttgcttttgaacagggtaaaatc
cttcctactcctgaaacagttccttttagactcaccagagatattgtggatggtatgggc
attactggtgttgaaggtgttttcagaagatgctgtgagaaaaccatggaggttatgaga
aactctcaggaaaccctgttaaccattgtagaggtcctcctgtatgatcctctctttgac
tggaccatgaatcctttgaaggctttgtatttacagcagaggctagaagatgaaactgag
ctccactcaactccaaatgcagctcaccgagaatgcaaacgaaatctcagtgatactgac
cagagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagagaaactgaaagga
gtggaggagggaaccgtgctcagtgtgggtggacaggtgaatttgctcatacaacaagcc
atggaccccaaaaatctcagccgacttttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system