KEGG   Pteropus alecto (black flying fox): 102889369
Entry
102889369         CDS       T02993                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04350  TGF-beta signaling pathway
pale04371  Apelin signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04714  Thermogenesis
pale04910  Insulin signaling pathway
pale04931  Insulin resistance
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05221  Acute myeloid leukemia
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102889369 (RPS6KB1)
   04350 TGF-beta signaling pathway
    102889369 (RPS6KB1)
   04371 Apelin signaling pathway
    102889369 (RPS6KB1)
   04066 HIF-1 signaling pathway
    102889369 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    102889369 (RPS6KB1)
   04152 AMPK signaling pathway
    102889369 (RPS6KB1)
   04150 mTOR signaling pathway
    102889369 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102889369 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102889369 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889369 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    102889369 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    102889369 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102889369 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889369 (RPS6KB1)
   05205 Proteoglycans in cancer
    102889369 (RPS6KB1)
   05231 Choline metabolism in cancer
    102889369 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102889369 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889369 (RPS6KB1)
   05212 Pancreatic cancer
    102889369 (RPS6KB1)
   05225 Hepatocellular carcinoma
    102889369 (RPS6KB1)
   05226 Gastric cancer
    102889369 (RPS6KB1)
   05221 Acute myeloid leukemia
    102889369 (RPS6KB1)
   05224 Breast cancer
    102889369 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102889369 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102889369 (RPS6KB1)
   05163 Human cytomegalovirus infection
    102889369 (RPS6KB1)
   05165 Human papillomavirus infection
    102889369 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102889369 (RPS6KB1)
   01522 Endocrine resistance
    102889369 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102889369 (RPS6KB1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102889369 (RPS6KB1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102889369 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102889369
NCBI-ProteinID: XP_006924963
UniProt: L5JTV9
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LGRKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccagacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctagaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagatacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagttacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctgggtaggaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacgcctgtggaatacccaatggaaacaagtgga
gtagagcagatggatgtgacgatgagtggggaagcttcagccccacttccaatacgacaa
ccgaactccgggccatataaaaaacaggcttttcccatgatatccaaacgaccagagcac
ctgcgtatgaatctatga

KEGG   Pteropus alecto (black flying fox): 102891214
Entry
102891214         CDS       T02993                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04350  TGF-beta signaling pathway
pale04371  Apelin signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04714  Thermogenesis
pale04910  Insulin signaling pathway
pale04931  Insulin resistance
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05221  Acute myeloid leukemia
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102891214 (RPS6KB2)
   04350 TGF-beta signaling pathway
    102891214 (RPS6KB2)
   04371 Apelin signaling pathway
    102891214 (RPS6KB2)
   04066 HIF-1 signaling pathway
    102891214 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    102891214 (RPS6KB2)
   04152 AMPK signaling pathway
    102891214 (RPS6KB2)
   04150 mTOR signaling pathway
    102891214 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102891214 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102891214 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102891214 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    102891214 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    102891214 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102891214 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891214 (RPS6KB2)
   05205 Proteoglycans in cancer
    102891214 (RPS6KB2)
   05231 Choline metabolism in cancer
    102891214 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102891214 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102891214 (RPS6KB2)
   05212 Pancreatic cancer
    102891214 (RPS6KB2)
   05225 Hepatocellular carcinoma
    102891214 (RPS6KB2)
   05226 Gastric cancer
    102891214 (RPS6KB2)
   05221 Acute myeloid leukemia
    102891214 (RPS6KB2)
   05224 Breast cancer
    102891214 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102891214 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102891214 (RPS6KB2)
   05163 Human cytomegalovirus infection
    102891214 (RPS6KB2)
   05165 Human papillomavirus infection
    102891214 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102891214 (RPS6KB2)
   01522 Endocrine resistance
    102891214 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102891214 (RPS6KB2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102891214 (RPS6KB2)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102891214 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102891214
NCBI-ProteinID: XP_006911084
LinkDB
Position
Unknown
AA seq 482 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLAELRAAGLEPVGHYEEVELTETSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGSNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHINWDDLLARRVDPPFRPCLQSEDDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIREGFNFQPKLRSPRRLNSSPRT
PISPLKLSPFEGFRPSPGPPEPMEPPLPPLLPPPPPSSTAPLPIQPPSGTKKSKRGRGRP
GR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgag
ccagagttcagccccgcggacgtgtgtccccttgccgagttgagggctgctggcctggag
cctgtgggacactatgaagaggtggagctcactgagaccagtgtgaacctgggccctgag
cgcattggaccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcagggcagcaacttgggcaaaatatacgccatgaaagtc
ctgaggaaggccaaaattgtgcgcaacgccaaggacacggcacacacacgggctgagcgg
aacattctagagtccgtgaagcaccccttcattgtggaactggcctacgccttccagact
ggtggcaaactctacctcatcctcgagtgcctcagtggcggcgagctcttcacacatctt
gagcgagagggcatcttcctggaagacacggcctgtttctacctagcagagatcacactg
gccctgggccacctccactcccaaggcatcatctaccgggacctcaaaccagagaacatc
atgctcaacagccagggccacatcaaactgacggactttggactctgcaaggagtcgatt
cacgagggcgctgtcacccacaccttctgtggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccacccttcactgcagagaaccggaagaagaccatggacaag
atcatcaaagggaagctggtgctgcccccgtacctcaccccggatgcccgcgacctcgtc
aaaaagtttctgaagcggaatcccagccagcggatcgggggcggccccggggacgctgcc
gatgtgcagaggcaccccttttttcggcacattaattgggacgatctcctggcccgccgc
gtggacccccctttccggccctgtctgcaatcagaggacgacgtgagccagtttgacacc
cgcttcacacggcagacgccagtggacagcccagacgacacggccctcagtgagagcgcc
aaccaggccttcctgggcttcacatacgtggcgccctccgtcctggacagcatcagagag
ggcttcaactttcagcccaaactgcgctcccccagacgcctcaacagcagcccccggacc
cccatcagccccctgaagttgtcaccctttgaggggttccggcctagccctggcccaccg
gagcccatggagccccctttacctcctctcctgccgccgccaccaccctcaagcactgcc
cctctccccatccaacccccctcggggaccaagaagtctaagaggggtcgcgggcgccct
gggcgctag

DBGET integrated database retrieval system