KEGG   Pteropus alecto (black flying fox): 102889604
Entry
102889604         CDS       T02993                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04010  MAPK signaling pathway
pale04071  Sphingolipid signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04137  Mitophagy - animal
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04216  Ferroptosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04722  Neurotrophin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102889604 (TP53)
   04310 Wnt signaling pathway
    102889604 (TP53)
   04071 Sphingolipid signaling pathway
    102889604 (TP53)
   04151 PI3K-Akt signaling pathway
    102889604 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102889604 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102889604 (TP53)
   04210 Apoptosis
    102889604 (TP53)
   04216 Ferroptosis
    102889604 (TP53)
   04115 p53 signaling pathway
    102889604 (TP53)
   04218 Cellular senescence
    102889604 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102889604 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102889604 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102889604 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889604 (TP53)
   05202 Transcriptional misregulation in cancer
    102889604 (TP53)
   05206 MicroRNAs in cancer
    102889604 (TP53)
   05205 Proteoglycans in cancer
    102889604 (TP53)
   05203 Viral carcinogenesis
    102889604 (TP53)
   05230 Central carbon metabolism in cancer
    102889604 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889604 (TP53)
   05212 Pancreatic cancer
    102889604 (TP53)
   05225 Hepatocellular carcinoma
    102889604 (TP53)
   05226 Gastric cancer
    102889604 (TP53)
   05214 Glioma
    102889604 (TP53)
   05216 Thyroid cancer
    102889604 (TP53)
   05220 Chronic myeloid leukemia
    102889604 (TP53)
   05217 Basal cell carcinoma
    102889604 (TP53)
   05218 Melanoma
    102889604 (TP53)
   05219 Bladder cancer
    102889604 (TP53)
   05215 Prostate cancer
    102889604 (TP53)
   05213 Endometrial cancer
    102889604 (TP53)
   05224 Breast cancer
    102889604 (TP53)
   05222 Small cell lung cancer
    102889604 (TP53)
   05223 Non-small cell lung cancer
    102889604 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102889604 (TP53)
   05014 Amyotrophic lateral sclerosis
    102889604 (TP53)
   05016 Huntington disease
    102889604 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102889604 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889604 (TP53)
   05161 Hepatitis B
    102889604 (TP53)
   05160 Hepatitis C
    102889604 (TP53)
   05162 Measles
    102889604 (TP53)
   05168 Herpes simplex virus 1 infection
    102889604 (TP53)
   05163 Human cytomegalovirus infection
    102889604 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102889604 (TP53)
   05169 Epstein-Barr virus infection
    102889604 (TP53)
   05165 Human papillomavirus infection
    102889604 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102889604 (TP53)
   01522 Endocrine resistance
    102889604 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102889604 (TP53)
   03036 Chromosome and associated proteins [BR:pale03036]
    102889604 (TP53)
   03400 DNA repair and recombination proteins [BR:pale03400]
    102889604 (TP53)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102889604 (TP53)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102889604 (TP53)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102889604 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 102889604
NCBI-ProteinID: XP_006922397
UniProt: L5JZ91
LinkDB
Position
Unknown
AA seq 378 aa
MDIPQSELNMEPPLSQETFSDLWKLLPQNNVLPPDISLPENEFLLPSVLVNWLDEDQNES
PRVPAAATPAPATSWPLSSFVPSQKTYPGSYDFRLGFLNSGTAKSVTCTYSPTLNKLFCQ
LAKTCPVQLWVSSPPPLGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSDGLAPPQHLI
RVEGNLRAEYLDDKHTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPILTII
TLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPKKPPGSTKRALPTDTTSS
SPSPKMPLDEEYFTLQIRGRKNFEILRELNEALELKDAQAGKEPRGSRAHSSHLKSKKGQ
STSCHKKLTLKREGPDSN
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggatatacctcagtcagaactcaatatggagccccctctgagtcaggagacattttca
gacttgtggaaactacttcctcaaaacaacgttctgccccccgacatatccctgccagag
aatgaatttttgctgccctcagtccttgtgaactggctggatgaagatcaaaatgaatcc
cccagggtcccagcagctgccaccccagcaccagccacctcctggcccttgtcatccttt
gtcccttcccagaagacttaccctggcagctatgattttcgtttaggattcctgaattct
gggacagccaagtcggtaacctgcacgtactctcctaccctcaacaagctgttttgccag
ctagcaaagacctgccctgtgcagctctgggtcagctccccacccccacttggtacccgt
gtccgagccatggccatctacaagaaatctgagtacatgacagaggtggtgaggcgctgc
ccccaccatgaacgctgttctgactatagcgatggtctggcccctcctcagcatcttatc
cgggtggaagggaatttgcgtgccgagtatttggatgacaaacatacttttcgacatagt
gtggtggtaccctacgagccgcctgaggtgggttctgattgtaccactatccactacaac
ttcatgtgtaatagctcctgcatggggggtatgaaccgacggcccatcctcaccatcatc
acactggaagactccagtggtaatctgctgggacggaacagctttgaggtacgtgtttgt
gcctgtcctgggagagaccggcgcacagaggaagagaatttccacaagaagggggaacct
tgtcccaagaagccccctgggagcactaagcgagcactgcccaccgataccaccagctcc
tctccctcaccaaagatgccattggatgaagaatattttactcttcagatccgtggacgt
aaaaacttcgagatattacgagaactgaatgaggccttagagctgaaggatgctcaggct
ggaaaggagcccaggggaagcagggctcactccagccacctgaagtctaagaaggggcag
tctacctcctgccataaaaaactcacgttgaagagagaggggcctgactcaaattga

DBGET integrated database retrieval system