KEGG   Pteropus alecto (black flying fox): 102889618
Entry
102889618         CDS       T02993                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04144  Endocytosis
pale04218  Cellular senescence
pale04350  TGF-beta signaling pathway
pale04380  Osteoclast differentiation
pale04390  Hippo signaling pathway
pale04520  Adherens junction
pale04659  Th17 cell differentiation
pale04926  Relaxin signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05142  Chagas disease
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102889618 (TGFBR2)
   04350 TGF-beta signaling pathway
    102889618 (TGFBR2)
   04390 Hippo signaling pathway
    102889618 (TGFBR2)
   04068 FoxO signaling pathway
    102889618 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889618 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102889618 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102889618 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102889618 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102889618 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102889618 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102889618 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889618 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102889618 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102889618 (TGFBR2)
   05212 Pancreatic cancer
    102889618 (TGFBR2)
   05225 Hepatocellular carcinoma
    102889618 (TGFBR2)
   05226 Gastric cancer
    102889618 (TGFBR2)
   05220 Chronic myeloid leukemia
    102889618 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102889618 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889618 (TGFBR2)
   05161 Hepatitis B
    102889618 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102889618 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102889618 (TGFBR2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102889618 (TGFBR2)
Protein kinases [BR:pale01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102889618 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102889618
NCBI-ProteinID: XP_006905778
UniProt: L5L3V9
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMMVNDSNGAVKFPQLCKFCDVRSST
CDNQKLCKSNCSITSICEKPHEVCVAVWRKNDENITLETVCHDPKLVYHGFVLEDAASPK
CFMKEKKVDGETFFMCSCNTDECNDHIIFSEENSTNNPDLLSVIFQVTGVSLLPPLGIAI
AVIITFYCYRVHRKQKLTPSWETNKPRKLMEFSEHLAIIMEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKMEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLSTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctctggacgcgcatc
gccagcacgatcccgccacacgttcagaagtcggttaataatgacatgatggtcaatgac
agcaatggtgctgtcaaatttccacagttgtgtaaattttgtgatgtaagatcttccacc
tgtgacaaccagaaactctgcaagagcaactgcagtatcacgtccatctgtgaaaagcca
cacgaagtctgtgtggccgtctggagaaagaatgatgagaacataacactagagaccgtt
tgccatgaccccaagcttgtctaccacggatttgttcttgaggatgctgcttctccaaag
tgttttatgaaggaaaaaaaagtggatggcgagactttctttatgtgttcctgtaacact
gatgagtgcaatgaccacatcatcttctcagaagaaaattccaccaacaaccctgacttg
ttgtcagtcatattccaagtgacaggcgtcagcctcctcccaccactgggcatcgccata
gccgtcatcatcaccttctactgctaccgtgttcaccggaagcagaagctgaccccgtcc
tgggagaccaacaagccacggaagctcatggagttcagcgagcatcttgccatcattatg
gaagacgaccgctccgacatcagctccacgtgcgccaacaacatcaaccacaacacggag
ctgctgcccattgagctggacaccctggtgggcaaaggtcgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcggagcagttcgagactgtggcagtcaagatcttccct
tatgaggagtatgcctcctggaagatggagaaggacattttctcagatatcaatctgaaa
catgagaacatcctccagttcctgacggccgaagagcggaagacggagttggggaagcaa
tattggctgatcaccgctttccatgccaagggcaacctacaggagtacctcacgcggcac
gtcatcagctgggaggacctgcgcaagctgggcagctccctggcccggggcattgctcac
ttgcacagcgaccacaccctgtgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctggtgaagaatgacctgacctgctgcctgtgtgacttcgggctt
tccctgcgtctggaccccacactgtctgtggatgacttggccaacagtggacaggtggga
actgccagatacatggccccagaagtccttgagtccaggatgaatttggagaatgtcgag
tccttcaagcagacagatgtctactcaatggcgctggtgctctgggagatgacgtctcgc
tgcaatgctgtgggagaggtgaaagattatgagccgccgtttggttccaaggtgcgggag
catccctgtgtcgaaagcatgaaggacaatgtgttgcgagatcggggacgaccagaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgtgagactctgaccgagtgc
tgggaccatgaccctgaggcccgcctcacggcccagtgtgttgccgagcgcttcagtgag
ctggagcacctggaccgactctcggggaggagctgctccgaggagaagattccggaagac
ggctcgctgagcactaccaaatag

DBGET integrated database retrieval system