KEGG   Pteropus alecto (black flying fox): 102889752Help
Entry
102889752         CDS       T02993                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04330  Notch signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04919  Thyroid hormone signaling pathway
pale05020  Prion diseases
pale05165  Human papillomavirus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102889752 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102889752 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102889752 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889752 (NOTCH1)
   05206 MicroRNAs in cancer
    102889752 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    102889752 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    102889752 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102889752 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102889752 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 DUF3454 Ank NODP Ank_5 Ank_4 Ank_3 Notch EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 102889752
NCBI-ProteinID: XP_024907025
LinkDB All DBs
Position
Unknown
AA seq 2474 aa AA seqDB search
MGPAGGVAPVAEALGWARSGRSLRCKLRRGLRGPAVPGAQPLPQRPLQERGDLPRAGARR
RAGLHLQLPPGLLRAPLPDALGQRLPRCRVCHSCGEAFAGQRCQAHSPCLSAPCKNAGTC
HVLERGGVLAYTCSCRLGFSGPLCLTPWDNACLASPCRNGGTCDLLTLTEYKCRCPPGWS
GKTCQQADPCASNPCANGGQCLPFEASYICGCPAGFHGPTCRQDVNECSQSPGPCLNGGT
CLNELGSYRCACRASHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFTGHSC
EENIDDCPGHGCQNGGTCVDGVNTYNCRCPPEWTGQYCTKDMDECQLMPNACQNGGTCHN
ANGGFNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLND
ACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHKGRCINTLG
SFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDEC
ASSPCLQNGRCLDKINGFLCQCPTGFTGSLCQYDVDECASTPCRNGAKCLDGPNTYTCVC
TEGYTGPHCEVDINECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRH
GGTCQDRDNAYQCLCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGFECACEPGYTGSM
CNINIDECAGDPCHNGGTCQDGINGFSCRCPEGYHDPTCLSEVDECDSNPCIHGVCRDGL
NGYKCDCEPGWSGASCDINNNECESNPCVNGGTCKDMTSGYVCACREGFSGPNCQTNINE
CASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPGPCRNGGACKASEDYESFS
CVCPPGWQGQTCEVDINECVKSPCRNGASCQNTNGGYRCHCPAGYTGRTCETDIDDCRPN
PCHNGGSCTDGVNMAFCGCLPGFQGTFCEEDIDECASNPCHNGANCTDCVASYTCTCPTG
FSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSRPCLHGG
TCQDSYGTYKCSCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNTQYRCECHSGWTGLYC
DVPSVSCEVAAWQQGIDVTSLCRNGGLCMDAGSTHHCRCQAGYTGSYCEDQVDECSPNPC
HNGATCTDYPGGYSCKCVAGYHGVNCSEEINECLSHPCQNGGTCIDLTNTYKCSCPRGTQ
GVHCEVDVDDCSPPIDPVSRGPKCFNNGTCVDQVGGYSCTCLPGFVGERCEGDVNECLSN
PCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCQNGGTCAVASNTARGFIC
KCPEGFEGATCENDARTCGSLRCLNGGTCTSGPRSPTCLCRSAFTGRECQFPAGSPCVDS
NPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFRGGVGLDITPPQIEEACELPEC
QAEAGNKVCSLRCNNHACGWDGGDCSLNFNDPWQNCTQSLECWKYFSNGRCDSQCSSAGC
LFDGFDCQGTDGQCKCGGRWRRELDPMDVRGSIVYLEIDNRQCVQSSSQCFQSTTDVAAF
LGALASLGSLNIPYKIEAVQSETVEPPPSPPLHFMYVAVVALVLLIFVGCGVLLSRKRRR
QHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNTSDGALMDDNQNEWGDEDLETKK
FRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEADTDCMDVNVRGPDGF
TPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSD
AAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILA
ARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVALLKHGANKDMQNSKEE
TPLFLAAREGSYETAKALLEHCANRDIADHMDRLPRDIAQERMHHDIVRLLDEHGLARGA
PLGGAPTLSPPLCSPSGYLGSLRPAVQGKKARKPSTKGLASGGKEARDLKARRKKSQDGK
GCLLDSASVLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLSHLPGMPDTHLGLSHL
GVAAKPEMAALGGGGRLAFEAGPPRLSHLPVASSTSTVLGSGSGSGAVNFAVGGTTGLNG
QCEWLSRLQSGLVPNQYNPLRGSVAPGTLSTQAPALQHGMIGPLHGGLSATALSQMLSYQ
ALPNTRLTTQPHLVPTQQVQQQQNLQMQQQQSMQPPPNLPPPSIQQQQNLQPPPQPHLGV
SSAASGHIGRSFLGGEPSQADVQPLGPSSLAVHTTLPQDSQALPTPLPSSLVPPMTTAQF
LTPPSQHSYSSPMDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPT
SMQSQIAHVPEAFK
NT seq 7425 nt NT seq  +upstreamnt  +downstreamnt
atggggccggccggaggtgtggctccagtcgctgaggccctgggctgggcccgctctggg
aggtccctgcgttgcaagctgcggcgaggccttcgcgggccagcggtgccaggcgcacag
cccctgcctcagcgccccctgcaagaacgcggggacctgccacgtgctggagcgcggcgg
cgtgctggcctacacctgcagctgccgcctgggcttctccgggcccctctgcctgacgcc
ctgggacaacgcctgcctcgctgccgtgtctgccacagctgcggcgaggccttcgcgggc
cagcggtgccaggcgcacagcccctgcctcagcgccccctgcaagaacgcggggacctgc
cacgtgctggagcgcggcggcgtgctggcctacacctgcagctgccgcctgggcttctcc
gggcccctctgcctgacgccctgggacaacgcctgcctcgccagcccctgccgtaacggc
ggcacctgcgacctgctcacgctcacagagtacaagtgccgctgtccaccgggctggtca
gggaagacgtgccagcaggctgacccgtgcgcctccaacccctgtgccaacggcggccag
tgcctgcccttcgaggcctcgtacatctgcggctgcccggccggcttccacgggcccacc
tgccggcaggacgtgaacgagtgcagccagagccccgggccctgcctcaacggcggcacc
tgcctcaacgagctgggctcctaccgctgcgcctgccgcgccagccacaccggcccccac
tgcgagctgccctacgtgccctgcagcccctccccctgccagaacggcggcacctgccgc
cccacgggggacaccacgcatgagtgcgcctgcctgccagggttcaccggccacagctgt
gaagaaaacatcgacgactgtccaggacacggctgccagaacgggggcacctgcgtggac
ggggtgaacacctacaactgccgctgcccgccggagtggacaggccagtactgcaccaag
gacatggacgagtgccagctgatgcccaacgcctgccagaacggcgggacctgccacaac
gccaacggcggcttcaactgcgtgtgcgtcaacggctggacgggtgaggactgtagtgag
aacatcgacgactgcgccagcgccgcctgcttccacggcgccacctgccacgaccgcgtg
gcctccttctactgcgagtgtccccacggccgcaccggcctgctgtgccacctcaacgac
gcctgcatcagcaacccctgcaacgagggctccaactgcgacaccaaccccgtcaacggc
aaggccatctgcacctgcccttcggggtacacggggccagcctgtagccaggacgtggat
gagtgttcgctgggcgccaacccctgtgagcacaaaggcaggtgcatcaacacgctgggc
tccttcgagtgccagtgtctgcagggctacaccggcccccgctgtgagatcgacgtcaac
gagtgcgtctcgaacccgtgtcagaacgacgccacctgcctggaccagatcggggagttc
cagtgcatctgcatgcccggctacgagggcgtgcactgcgaagtgaacacggacgagtgt
gccagcagcccctgcctgcagaacggccgctgcctggacaagatcaatgggttcctgtgc
cagtgccccacaggcttcaccgggagcctgtgccagtacgatgtggacgagtgcgcaagc
acaccctgcaggaacggcgccaagtgcctggacgggcccaacacctacacctgcgtgtgc
acggagggctacacggggccccactgcgaggtggacatcaacgagtgcgaccccgacccc
tgccactacgggtcctgcaaggacggcgtcgccaccttcacctgcctgtgccagccgggc
tataccggccaccactgcgagaccaacatcaacgagtgccacagccagccctgccgccac
gggggcacctgccaggaccgcgacaacgcctaccagtgcctctgcctcaaggggaccaca
ggacccaactgtgagatcaacctggacgactgtgccagcagcccctgtgactcgggcacg
tgtctggataagatcgatggcttcgagtgtgcgtgtgagccaggctacacaggaagcatg
tgcaacatcaacatcgatgagtgtgccggggacccctgccacaatgggggcacctgccag
gacggcatcaacggcttcagctgccgctgcccggagggctaccacgaccccacgtgcctg
tctgaggtggacgagtgcgacagcaacccctgcatccacggggtctgccgggacggcctc
aacgggtacaagtgtgactgtgagcctgggtggagcggggccagctgcgacatcaacaat
aacgagtgcgagtccaacccctgtgtcaacggtggcacctgcaaggacatgaccagcggc
tacgtgtgcgcctgccgggaaggcttcagtggccccaactgccaaaccaacatcaacgaa
tgtgcatccaacccgtgtctgaaccagggcacgtgtatcgatgacgtggccgggtacaag
tgcaactgcctgctgccctacacaggagccacgtgtgaggtggtgctggccccatgtgcc
cctggcccctgcaggaacggtggcgcgtgcaaggcgtctgaggactatgagagcttttcc
tgcgtctgccccccgggctggcaggggcagacctgcgaggtcgacatcaacgagtgtgtg
aagagcccgtgccgcaacggagcctcctgccagaacaccaacggcggctaccgctgccac
tgcccggcgggctacacggggcgcacctgcgagacggacatcgacgactgccggcccaac
ccatgccacaacggtggctcctgcacagacggtgtcaacatggccttctgcggctgcctg
cctggcttccagggcaccttctgtgaggaggacatcgacgagtgtgccagcaacccctgc
cacaacggcgccaactgcaccgactgtgtggccagctacacctgcacctgccccacaggc
ttcagcgggatccattgcgagaacaacacgcccgactgcacggagagctcctgcttcaat
ggtggcacctgtgtggacggcatcaactcctttacctgcctgtgtccaccgggcttcacg
ggcagctactgccagcacgacgtcaacgagtgtgactcgcgtccctgcctgcacggtggc
acctgccaggatagctatggcacgtacaagtgcagctgcccgcagggctacaccggcctc
aactgccaaaacctcgtgcgctggtgtgactcctcgccttgcaagaacggtggcaagtgc
tggcagaccaacacccagtaccgctgcgagtgccacagcggctggaccggcctctactgc
gacgtgcccagtgtttcctgtgaggtggccgcatggcagcaaggcatcgacgtgactagc
ctgtgccggaacgggggcctctgcatggacgcaggcagcacgcaccactgccgctgccag
gcgggctacaccggcagctactgcgaggaccaggtggatgagtgctcacccaacccctgc
cacaacggcgccacctgcacggactaccccggcggctactcctgcaagtgcgtggccggc
taccatggggtgaactgctccgaggagatcaacgagtgcctgtcccacccgtgccagaat
gggggcacctgcatcgacctcaccaacacgtacaagtgttcctgtccccggggcactcag
ggcgtgcactgtgaggtagacgtggacgactgcagcccccccatcgaccccgtgtcccgg
ggccccaagtgcttcaacaacggcacctgcgtggaccaggtgggcggctacagctgcacc
tgcctgcccggcttcgtgggcgagcgctgtgagggcgatgtcaacgagtgcctgtccaac
ccctgtgacgcccgcggcacccagaactgcgtgcagcgcgtcaatgacttccactgcgag
tgtcgtgccggccacaccgggcgccgctgcgaatcggtcatcaacggctgcaaagggaag
ccatgccagaatgggggcacctgcgccgtggcctccaacacggcccgcgggttcatctgc
aaatgcccggagggcttcgaaggcgccacgtgcgagaacgacgcacgcacctgcggcagc
ctgcggtgcctgaacggcggcacctgcacctcgggcccgcgcagccccacctgcctgtgc
cggagcgccttcaccggccgcgagtgccagttcccggccggcagcccctgcgtggacagc
aacccctgctacaaccagggcacctgcgagcccacgtccgagagcccgttctaccgctgc
ctgtgccccgccaagttcaacgggctcctgtgccacatcctggactacagcttccggggg
ggcgtggggctggacatcactccgccgcagatcgaggaggcgtgcgagctgcccgagtgc
caagcggaggccggcaacaaggtgtgcagcctgcggtgcaacaaccacgcgtgcggctgg
gacggcggcgactgctccctcaacttcaacgacccgtggcagaactgcacgcagtcgctg
gagtgctggaagtacttcagcaacggccgctgcgacagccagtgcagctcggccggctgc
ctcttcgacggcttcgactgccagggcacggacggccagtgcaagtgcggcggccgctgg
cgcagggagctggacccgatggacgtccgcgggtctatcgtctacctggagatcgacaac
cggcagtgtgtccagtcgtcctcacagtgcttccagagcaccacggacgtggccgccttc
ctgggggcgctggcctcgctgggcagcctgaacatcccctacaagattgaggctgtgcag
agtgagacggtggagccaccgccctccccaccgctgcacttcatgtacgtggccgtggtc
gccctcgtcctgctgatcttcgtgggctgcggggtcctgctgtcccgcaagcggcggcgg
cagcatggccagctctggttccccgagggcttcaaggtgtcggaggccagcaagaagaag
cggcgggagcccctgggcgaggactccgtgggcctcaagcccctgaaaaatacctcggac
ggcgccctcatggatgacaaccagaacgagtggggtgacgaggatctggagaccaagaag
ttccggttcgaggagccagtggttcttcctgacctggatgaccagacagaccaccgacag
tggacccagcagcacctggacgccgccgacctgcgtgtgtccgccatggcccccacaccg
ccccagggcgaggccgacaccgactgcatggacgtcaacgtccgtgggcctgacggcttc
acgcctctgatgatagcctcgtgcagcggagggggcctggagaccggcaacagcgaggag
gaggaggacgcaccggccgtcatctcggacttcatctatcagggcgccagcctgcacaac
cagacggaccgcaccggtgagaccgccctgcacctggccgcccgctactcacgctctgac
gcggccaagcgcctactggaggccagcgccgacgccaacatccaggacaacatggggcgc
acgccgctgcacgcggctgtgtctgccgacgcccagggcgtcttccagatcctgatccgg
aaccgagccacagacctggacgcccgcatgcacgacggcacgacgccgctgatcctggcc
gcccggctggccgtggagggcatgctggaggacctcatcaactcccatgccgacgtcaac
gccgtggatgacctgggcaagtccgccctgcactgggccgcggccgtgaacaacgtggac
gccgccgtggcgctgctgaagcatggtgccaacaaggacatgcagaacagcaaggaggag
acgccgctgttcctggccgcccgggagggcagctacgagacggccaaggcactgctggag
cactgtgccaaccgggacatcgccgaccacatggaccgcctgccgcgggacatcgcacag
gagcgcatgcaccacgacatcgtgcggctgctggacgagcacggcctggcgcgcggcgcc
cccctgggcggcgcgcccaccctgtcgcccccgctctgctcgcccagcggctacctgggc
agcctcaggcccgccgtgcagggcaagaaggcccgcaagcccagcaccaagggcctggct
agtggaggcaaggaggccagggacctcaaggcccggaggaagaagtcccaggacggcaag
ggctgcctgctggacagcgcgagcgtgctgtcccccgtggactccctcgagtcgccccac
ggctacctgtcggacgtggcctcgccacccctcctgccttcccccttccagcagtctccg
tccgtgcccctcagccacctgccgggcatgcccgacacccacctgggcctcagccacctg
ggtgtggcggccaagcccgagatggcagcgctgggcgggggcggccggctggccttcgag
gctgggccgccacgcctctcccacctgcctgtggcttccagcaccagcacagtcctgggt
tctggcagtggcagcggggccgtgaattttgccgtgggcggaaccacgggcttgaacggc
cagtgcgagtggctgtctcgactgcagagtggtctggtgccaaaccagtacaacccactg
cgagggagcgtggccccgggcacgctgagcacacaggcccctgccctgcagcacggcatg
ataggtccgctgcacggcggcctctccgccactgccctgtcccagatgctaagctaccag
gccctgcccaacacgcggctgaccacccagcctcacctggtgccgacccagcaggtgcag
cagcagcaaaacttacagatgcagcagcagcagagcatgcagccgccgccgaacctgccg
ccaccgagcatccagcagcagcagaacctgcagccgccgccccagccacacctcggcgtg
agctcggccgccagcggccacatcggccggagcttcctgggtggggagccgagccaggca
gacgtgcagccactgggccccagcagcctggcggtgcacaccaccctaccacaggacagc
caagccctgcccacgccactgccgtcctccctggtcccgcccatgaccaccgcccagttc
ctgacgccgccctcgcagcacagctattcctctcccatggacaacacccccagccaccag
ctgcaggtgcccgagcaccccttcctcaccccgtcccccgagtcccccgaccagtggtcc
agctcctccccacactccaacatctccgattggtccgagggcatctccagcccgcccacc
agcatgcagtcccagatcgcccacgtcccggaggccttcaagtaa

DBGET integrated database retrieval system