KEGG   Pteropus alecto (black flying fox): 102890025
Entry
102890025         CDS       T02993                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04672  Intestinal immune network for IgA production
pale05140  Leishmaniasis
pale05200  Pathways in cancer
pale05310  Asthma
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease
pale05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890025 (IL4)
   04151 PI3K-Akt signaling pathway
    102890025 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890025 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102890025 (IL4)
   04660 T cell receptor signaling pathway
    102890025 (IL4)
   04658 Th1 and Th2 cell differentiation
    102890025 (IL4)
   04659 Th17 cell differentiation
    102890025 (IL4)
   04657 IL-17 signaling pathway
    102890025 (IL4)
   04664 Fc epsilon RI signaling pathway
    102890025 (IL4)
   04672 Intestinal immune network for IgA production
    102890025 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890025 (IL4)
  09163 Immune disease
   05310 Asthma
    102890025 (IL4)
   05320 Autoimmune thyroid disease
    102890025 (IL4)
   05321 Inflammatory bowel disease
    102890025 (IL4)
   05330 Allograft rejection
    102890025 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102890025 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890025 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102890025 (IL4)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102890025 (IL4)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Haparin
  Cytokines
   102890025 (IL4)
SSDB
Motif
Pfam: IL4 CK2S
Other DBs
NCBI-GeneID: 102890025
NCBI-ProteinID: XP_006923210
LinkDB
Position
Unknown
AA seq 136 aa
MGLTSQLIPALVCLLACTSNFTHGHRYSITLEEIIKTLNILTTRKDWCMELMVADVFAAP
KNTAEDEIFCRAVTVLRKVYKHHECVNRKFLGKLDRNLRSMARDYCPVEEAKKDTLKNVL
ETLRKTMQEKYSKSWS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgattccagctctggtgtgcttactagcatgtaccagcaac
ttcacccatggacacaggtacagtatcaccttagaagagatcatcaaaacgctgaacatc
ctcacaacgagaaaggactggtgcatggagctgatggtggcggacgtcttcgctgcccca
aagaacacagcggaggatgaaatcttctgcagggctgtgacggtgcttcggaaggtctac
aaacaccatgagtgcgtaaacagaaaattcctgggcaaacttgacaggaacctgcgcagc
atggccagggactactgtcctgtggaggaagccaagaaggatacattgaaaaacgtcttg
gaaacgctaaggaagaccatgcaagagaaatactcaaagagttggagctga

DBGET integrated database retrieval system