KEGG   Pteropus alecto (black flying fox): 102890150Help
Entry
102890150         CDS       T02993                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells isoform X4
  KO
K10846  DNA excision repair protein ERCC-5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    102890150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102890150
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102890150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_N 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 102890150
NCBI-ProteinID: XP_006909439
LinkDB All DBs
Position
Unknown
AA seq 1649 aa AA seqDB search
MPNIAEAERANYSGNGEHKSEKKSPEENLQSAVQSFCTRASGAPVGPKGDGHYPWSCPVT
HTREKIYAICSDYAFLNQANSIYKTPNPTRSSCLPDSTSLSAGNNSSRYIGIPTSTSEII
YNEENSLENLSNSLGKLPLAWEIDKSEFDGVTTNLKHKSGNVKKQISKKKTSDKKGRHQR
EWPQYSPLEDIKQRKVLDLRRWYCISRPQYKTSCGISSLISCWNFLYSTMGAGNLAPITQ
EEALHILGFQPPFEDIRFGPFTGNTTLMRWFRQINDHFHVKGCSYVLYKPHGKNKTAGET
ASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEATPVKANKAFSRGPLSPQEVEYWILI
GESSRKHPAIHCKRWADIVTDLNTQNPEYLDIRHLERGLQYRKTKKVGGNLHCIIAFQRL
NWQRFGLWNFPFGTIRQELQPPAHGQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK
KMSNISIWLNQALKGVRDRHGNSIENAHLLTLFHRLCKLLFFRIRPIFVFDGDAPLLKKQ
TLAKRRHKKDLATSDSKKTAEKLLKTFLKRQAIKTALRSKRDEALPSLTCVQREDDIYSL
PPLQEGEKNSSEEEDEKEWQERMNQKQALQEELFQNPRAVDIESEDFCSLPPEVKHEILT
DMKEFTKRRRTLFEAMPEESNDFSQYQLKGLLKKNYLNQHIENVQKEMNQQHSGQIQRQY
EDEGGFLKEVESRRVVSEDTSHYILIKGIQAEKIAEVDSESFPSSSKMHSMSFDTKSSPC
EKLKPEKESGATPPSPRTFLAMEAAMLPSSEEELESETQRQYNKRNASATVDGGSISPLT
LLAIQKALDDDEDVKVHVGNDVQMGGSGAKKLLVNSSDEEADEGLKKRDEKGMLLTTMPD
SASVNFVEECVTSTNNKKELADSAPSSSTVICQGSESNVPKEQMSFIHMVNEGFQTSDEP
AVSDRKDPFPLEKTVVIHRNASGLQSERGLTSTPLTSPNAVSGNEIYTKVLELQQDLCPS
ENKYNSSLSSDDETECEKYSASEVTGTVSLQEASNTLSVPSEATSNLENAVSFNGKECEN
FLKTIQERETMKSAGQDCISIPKFMEPTEISEESESDGSFIEVHSIISDDEPQANLAEDF
KPPSGQDEEELIGTKKEEATGDSEGLLRDNSESEALNIEPQEETEENADSSFNEWQDINL
EELETLESNLLVQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFGIPYIEAPMEAEAQ
CAILDLTDQTSGTITDDSDIWLFGARHVYKNFFSKNKFVEYYQYVDFHNQLGLDRNKLIN
LAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQKNKKIRPNPYDTK
VKKKLRKLHLSPGFPNPAIADAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKT
DESLFPVLKQLNTQQTQLRIDSFFRLAQQEKQDAKGIKSQRLNRAVTCMLRKEREETTSE
VEAVSVAMEKEFEFPDKAKGKTQKRSIANKWKESSSLKRTRLSDSKRESKCGGFLGEASQ
SSDASSSEDTDCLPLMNMQQRKAAGEAKFSSSDLQNTVKPDPVKDEGLTLSSSSDDDREK
TKPVLVTARSVFGKKKGKRTIRGRKKKLI
NT seq 4950 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacattgcagaagcagaaagggcaaattattctggaaatggtgagcacaaatct
gagaagaagtctcctgaagagaacctacaaagtgctgtacaatctttctgcactcgtgct
tcaggagcacccgtgggtccaaaaggagatggtcattatccatggagctgtccagtgacc
catactcgagagaaaatttatgccatctgttcagactatgcctttctcaatcaggcaaac
tcaatctataaaactccaaatccaacccgctcttcttgcctgcctgatagtacctcttta
tctgctggaaataattcatcaagatacattggcatcccaactagtacatcagaaatcatt
tacaatgaggaaaatagcttagaaaacttatccaatagcctgggcaagctacctcttgca
tgggaaattgataaatctgaatttgatggagtgaccacaaatttgaaacacaaatcaggc
aatgtaaagaaacaaatttctaagaaaaaaacttcagataaaaaaggaagacatcaaaga
gagtggcctcaatattctcctcttgaagatattaagcaacggaaagtattagacctcaga
cgatggtactgcataagccgaccacaatataagacttcttgtggtatctcctcattaatt
tcttgttggaatttcttatatagcacaatgggagctggaaatctcgcacctattacccaa
gaagaagctttacacattttgggctttcaacccccatttgaagatattagatttggccct
ttcactggaaatacaacacttatgagatggtttagacaaattaatgaccacttccatgta
aaaggatgctcgtatgttctatataaacctcatgggaagaataaaacagctggagaaact
gcttcaggggccttgtcgaagttaactcgtggattgaaagatgaatcgctggcttatatc
tatcattgccaaaatcattatttttgtccaattggctttgaagcaacccctgttaaagct
aataaagcattcagcaggggtcctctctcaccacaagaagtagaatattggatcttaatt
ggagaatcaagtagaaaacatcctgctattcactgtaaaagatgggcagatattgttact
gatctaaacactcaaaatccagaatatctagatatccggcacttagagagagggctacag
tatcgaaaaacgaagaaggttgggggaaatttgcattgtattatagcatttcagagactt
aattggcaaaggtttggcctttggaactttccctttggaaccattagacaagaattacaa
cctccagcacatggccagggaattgccaaatctgagagtgaagacaacatctccaaaaag
cagcatgggcgtctgggtcggtctttcagtgctagtttccatcaggattcagcatggaaa
aagatgtccaatattagcatttggttaaaccaagcgcttaaaggagtccgggatcgccat
ggaaactcaatagaaaatgctcatcttctcactttgtttcatcggctctgcaaactctta
ttttttcgaattcgtcctatttttgtatttgatggagatgctccactactgaagaaacag
actttggctaagagaaggcataaaaaagacctggcaaccagcgactccaagaaaactgca
gagaagcttttgaaaacatttttgaaaagacaagctatcaaaactgccttaagaagcaaa
agagatgaagcactgcccagtcttacttgtgttcaaagagaagatgatatctattctttg
ccacctttacaagagggagaaaaaaatagttcagaagaggaagatgaaaaagaatggcaa
gaaagaatgaatcaaaaacaagcattacaggaagagttgtttcagaatcctcgtgcagta
gatattgaatctgaagacttctgcagtctgccccccgaagtcaagcatgaaatcttgact
gatatgaaagaatttaccaagcgaagaagaacattatttgaagcaatgccagaggagtcc
aatgacttttcacagtaccagctcaaaggcttacttaaaaaaaactatctaaaccaacac
atagaaaatgtccaaaaggaaatgaatcagcaacattctggacaaatccaaaggcaatat
gaagatgaagggggctttttgaaggaggtagagtcaaggagagtggtctctgaagacacg
tcacattatattttgataaaaggtatacaagctgagaaaattgcagaagtggattcagag
tcttttccatcttccagcaaaatgcatagcatgtcttttgacacaaagtcatctccttgt
gaaaaactgaagccagagaaggaatctggtgctacccctccttctccaagaactttcctg
gctatggaagctgccatgctgccaagctctgaagaagagttggagagtgagactcaaagg
caatataataagaggaatgcatctgctactgtagacggaggctccatatcaccactgact
ctcctagctattcagaaagctcttgatgatgatgaggatgtgaaagtgcatgttgggaac
gatgtgcagatgggtgggtcaggagcgaaaaaactgctcgtgaacagttctgatgaggaa
gctgatgaaggacttaaaaagagagatgaaaaaggaatgctgttgacaacaatgcctgat
tcagccagtgtgaactttgtggaggaatgtgtaaccagcactaataataaaaaagagctg
gcagattcagctccttcgtcaagtactgtcatttgtcaaggtagtgaatctaatgttcca
aaagaacaaatgtcatttattcacatggttaatgaaggctttcagacaagtgatgagcct
gcggttagtgataggaaagatccatttcctttagagaaaacagtggttatacacagaaat
gcgtctgggctccagagtgaaagaggactgacatcaacacctctgacaagtccaaatgct
gtgtcagggaatgaaatatataccaaagtgcttgagttacagcaagatctttgtccatct
gagaataaatataattctagtctttcaagtgatgatgaaacagaatgtgaaaaatattct
gcttctgaagttactggcactgtcagtttgcaagaagcaagtaacacactaagtgttcct
tcagaggcaacaagtaacttagaaaatgcagtatcgtttaatggtaaagagtgtgagaat
ttcctgaaaaccatccaagaacgtgagacgatgaaatctgcaggccaggattgcatttca
attccaaagttcatggaaccaacggaaatttctgaagaaagtgaatctgatggaagtttc
attgaggtgcacagtataattagcgatgatgaacctcaagccaatttagccgaagatttc
aaacctccctctggacaagatgaagaggaactgataggaactaagaaagaagaagccact
ggtgactccgagggcctcctaagagacaactccgaaagtgaggccttgaatattgagcca
caggaggagactgaagaaaatgcagacagttctttcaatgaatggcaagatattaatttg
gaggagctagaaactctggagagtaaccttttagtacaacagaattcattgaaagctcaa
aaacagcagcaggaacggattgctgctactgttacaggacagatgtttttggaaagccag
gaacttcttcgcctgtttggaattccctacattgaggctcccatggaagcagaggctcag
tgcgccatcctggatctgactgatcaaacttctggaacaatcactgatgatagtgatatt
tggctgtttggagcacgacatgtctataagaacttttttagcaaaaacaagtttgtagaa
tattaccaatatgtggactttcacaaccaattaggattggaccggaacaaattaataaat
ttggcctatttgcttggaagtgattacacagaaggaataccaactgtaggttgtgttaca
gccatggaaattctcaatgaattccctggacatggcctggaacctctcctaaaattctca
gagtggtggcatgaagctcaaaaaaataagaagataagacctaatccttatgacaccaaa
gtgaaaaaaaaattaagaaagttgcacctctcacctggctttcctaacccagctattgca
gacgcctacctgaaacctgttgtggatgactccaagggatcatttctgtgggggaaacct
gatcttgacaaaattagagaattttgtcagcggtattttggctggaacaggacgaagact
gatgagtctctgtttcccgtgttaaagcaactgaacactcagcagacacaactccgaatt
gattctttctttagattagctcaacaggagaaacaagatgctaagggtattaagagccag
agacttaacagagctgtgacatgtatgctgagaaaagaaagagaagaaacaaccagtgaa
gtagaagcagtttctgttgccatggagaaagaatttgagtttcctgataaggcaaaaggt
aagacccagaagagaagcatagcaaataaatggaaagagtcatcaagcctgaaaagaacg
aggctttcggattcaaaacgagagagtaaatgtggtgggtttttgggggaggcctcccag
tcatctgatgcatcttcaagtgaggatactgattgtttacctttaatgaacatgcagcag
agaaaagcagctggagaggcaaaattcagctcttcagatttgcaaaacacagtgaaacca
gatcctgtaaaggatgaaggtttgactctgagcagctccagtgacgatgacagagagaaa
acaaaaccagtcctggtgactgccagatctgtgtttgggaagaaaaaagggaaacgaact
ataagaggaagaaagaaaaaactaatttaa

DBGET integrated database retrieval system