KEGG   Pteropus alecto (black flying fox): 102890309
Entry
102890309         CDS       T02993                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04068  FoxO signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04932  Non-alcoholic fatty liver disease
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102890309 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    102890309 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102890309 (BCL2L11)
   04215 Apoptosis - multiple species
    102890309 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890309 (BCL2L11)
   05206 MicroRNAs in cancer
    102890309 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102890309 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102890309 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102890309 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102890309 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N
Other DBs
NCBI-GeneID: 102890309
NCBI-ProteinID: XP_006909509
LinkDB
Position
Unknown
AA seq 196 aa
MAKQPSDVSSECEREGGQLEPAARPPQLRPGAPASVQIEPQGNLEGEGDRCPHGSPQGPL
APTASPGPFATRSPLFIFVRRCSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAL
NHYLSAMASLRQSQALPADLRPETWIAQELRRIGDEFNASYPRRVFLNNLHAAGAHPQVA
ILRLLRYILRLLWRMQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcgaagcaaccttccgatgtaagttctgaatgtgaaagagaaggtggacaattggag
cccgctgcccggcctcctcaactcaggcctggggcccctgcctctgtgcagatagagccg
caaggtaaccttgaaggcgaaggggaccgctgcccccacggcagccctcagggcccgctg
gccccgacggccagccctgggccttttgctaccagatccccactcttcatctttgtgaga
agatgctccctgctgtcacggtcctccagtgggtatttctcttttgacacagacaggagc
cctgcacccatgagttgtgacaaatcaacacaaacgccgagtcctccgtgccaggccttg
aaccactatctcagtgcgatggcctccctgcggcagtcccaggccctccccgcggacctg
cgcccggagacgtggatcgcacaggagctgcggcgcatcggggatgagttcaacgcatcc
tacccacgccgggtctttctgaataacctccatgccgcgggggcccacccccaggtggcc
atcctgcgacttttgcgttacatcctccgtctgctgtggaggatgcagtga

DBGET integrated database retrieval system