KEGG   Pteropus alecto (black flying fox): 102890394
Entry
102890394         CDS       T02993                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X2
  KO
K05448  vascular endothelial growth factor A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04926  Relaxin signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05219  Bladder cancer
pale05323  Rheumatoid arthritis
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102890394 (VEGFA)
   04014 Ras signaling pathway
    102890394 (VEGFA)
   04015 Rap1 signaling pathway
    102890394 (VEGFA)
   04370 VEGF signaling pathway
    102890394 (VEGFA)
   04066 HIF-1 signaling pathway
    102890394 (VEGFA)
   04020 Calcium signaling pathway
    102890394 (VEGFA)
   04151 PI3K-Akt signaling pathway
    102890394 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102890394 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102890394 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890394 (VEGFA)
   05206 MicroRNAs in cancer
    102890394 (VEGFA)
   05205 Proteoglycans in cancer
    102890394 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102890394 (VEGFA)
   05211 Renal cell carcinoma
    102890394 (VEGFA)
   05219 Bladder cancer
    102890394 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102890394 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102890394 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102890394 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102890394 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102890394 (VEGFA)
   05165 Human papillomavirus infection
    102890394 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102890394 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102890394 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102890394 (VEGFA)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102890394 (VEGFA)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102890394 (VEGFA)
SSDB
Motif
Pfam: PDGF VEGF_C CXCXC
Other DBs
NCBI-GeneID: 102890394
NCBI-ProteinID: XP_006926563
UniProt: L5JNB5
LinkDB
Position
Unknown
AA seq 190 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEQKAHQVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIRLHKVQHIGEMS
FLQHEKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtctcaggctgcgcccatggcagaaggagaacagaaagcccaccaagtggtg
aagttcatggatgtctaccagcgcagctactgccgtccaatcgagaccctggtggacatc
ttccaggagtatcccgatgagatcgagtatatctttaagccgtcctgtgtgcccctgatg
cggtgtggaggctgctgcaatgacgagggcctggagtgtgtgcccacggaagagttcaac
atcaccatgcagattatgcgtatcagacttcataaagtccagcacataggagagatgagc
ttcctacagcatgaaaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaat
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcacgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system