KEGG   Pteropus alecto (black flying fox): 102890472
Entry
102890472         CDS       T02993                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04137  Mitophagy - animal
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04722  Neurotrophin signaling pathway
pale04917  Prolactin signaling pathway
pale05213  Endometrial cancer
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102890472 (FOXO3)
   04151 PI3K-Akt signaling pathway
    102890472 (FOXO3)
   04152 AMPK signaling pathway
    102890472 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102890472 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    102890472 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102890472 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102890472 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102890472 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    102890472 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    102890472 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    102890472 (FOXO3)
   05223 Non-small cell lung cancer
    102890472 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102890472 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102890472 (FOXO3)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    102890472 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 102890472
NCBI-ProteinID: XP_006926117
LinkDB
Position
Unknown
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDSSSRAGSAMAIGGGGCGTLGAGLLLEDSARLLAPGGQDPGSGPAPAAGAPSG
ATQTPLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYSKSRSRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMTGTMNLNDGLADNLMDDLLDNITLPSSQPSPTGGLMQRSSSFPYTTKGS
GLGSPASSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYSTQTLQDLLASDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLSV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcgtccccggccccgctctctccactggaagtggagctggacccg
gagtttgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctcgggagaggcggccgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacagcagcagtcgggccggctcggccatggcgatcggc
ggcggcgggtgcggcacgctgggcgctgggctgctgctcgaggactcggcccggctactg
gctcccggagggcaggaccccgggtccgggccagcccccgccgcgggcgcgccgagcggg
gcgacgcagacgccgctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctccgggcagccgcggaaatgctcgtcgcggcggaacgcctgggggaacctgtcc
tacgcagacctgatcactcgcgccatcgagagctccccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaattctatccggcacaacctgtcgctacatagccggttcatg
cgtgtccagaacgaggggaccggcaagagctcttggtggattatcaaccctgacggaggg
aagagtgggaaggcaccccggcggcgggctgtctccatggacaacagcaacaagtatagc
aagagccgaagccgcgcagccaagaagaaggcagccctgcagacggctcctgagtcagcg
gacgacagtccctcccagctctccaagtggcctggcagccccacctcgcgcagcagcgat
gagctggatgcatggacggacttccgctcgcgcaccaattccaatgccagcacggtcagc
ggccgtctgtcacccatcctggcgagcacagaattggatgacgtccaggacgatgacgca
cccctctcccccatgctctacagcagctcagccagcctttcgccctctgtaagcaagccg
tgcaccgtggagctgccacggctgaccgacatgacgggcaccatgaatctgaatgatggg
ctggctgacaacctcatggatgacctgctggataacatcacgctcccgtcatcccagcca
tcccccaccggagggctcatgcagcggagctccagcttcccgtacaccaccaagggctct
ggcctgggctctccagccagctcctttaacagcacggtgtttggaccctcatctctgaat
tccctgcgtcagtctcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcacactatagcacccagacactccaggacctgctcgcttcagactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaattcccgccgaaacgtgatgcttcgcaatgacccaatgatgtcctttgctgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaactcag
ggcgctctcggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagcgac
tccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctttccgtc
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccatcatccgtagtgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaacgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system