KEGG   Pteropus alecto (black flying fox): 102890809Help
Entry
102890809         CDS       T02993                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00500  Starch and sucrose metabolism
pale01100  Metabolic pathways
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04910  Insulin signaling pathway
pale04922  Glucagon signaling pathway
pale04931  Insulin resistance
Module
pale_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102890809 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102890809 (GYS2)
   04152 AMPK signaling pathway
    102890809 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102890809 (GYS2)
   04922 Glucagon signaling pathway
    102890809 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    102890809 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pale01003]
    102890809 (GYS2)
Enzymes [BR:pale01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102890809 (GYS2)
Glycosyltransferases [BR:pale01003]
 Polysaccharide
  Storage polysaccharide
   102890809 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102890809
NCBI-ProteinID: XP_006912736
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MLRGRSLSVASLSGLPQWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKARTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPLNDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACHVGIPYHDREANDMLIFGSLTAWFLKEVTDHAEGKHVIAQFH
EWQAGTGLVLSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERAAVHCAHVFTTVSEITAIEAEHMLRRKPDVITPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFFFIAGRYEFSNKGADIFLESLSRLNFLLRVHKSDV
TVVVFFIMPAQTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNGRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFYMEPTSPPSTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEDEDERYDEEEEAERDRLNIKSPFPLGHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatctgtggcatccctcagtgggcttcctcagtgggaagtt
gaagaacttccagtggaggatttactgctctttgaagtcgcttgggaagtgaccaataaa
gttggtggcatctacactgtgattcagacaaaggccagaacaacagcagatgaatgggga
gacaattattttctgattggtccgtattttgagcataatatgaagactcaggtagaacag
tgtgaacctttaaatgatgctgttagaaaagcagtggatgcaatgaataaacatggctgc
caggtacattttggaagatggctgatagaagggagtccttacgtggtgctctttgacata
ggttattcggcttggaatctggacaggtggaagggtgacctctgggaagcatgccatgtc
ggcatcccttatcacgaccgagaagccaatgatatgttgatttttggatctttaactgcc
tggttcttaaaagaggtgacagaccatgcagaaggtaaacatgttattgcccaattccac
gaatggcaggccggaacaggactggtcctttctcgggcccggaaacttccaatcgctaca
atatttactactcacgccacactgcttgggaggtatctctgtgcagcaaacattgatttc
tacaaccatcttgataagtttaacatagacaaagaggctggggaaaggcagatttatcat
cggtattgcatggagcgagccgcagtccattgtgctcatgtgttcaccacagtttctgaa
ataacagcaatagaggcagaacacatgctgaggagaaagcctgatgtaattactccaaat
ggcttgaacgttaagaaattttcagcagtacatgaatttcaaaatctacatgcaatgtac
aaagccaggattcaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttctttttcattgctgggaggtatgagttttcaaataaaggagctgac
atcttcctagaatccttatccaggctaaatttcttgctgagggtgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgcccagacaaataatttcaatgtggaaaccctg
aaaggccaggcagtacgaaaacagctatgggacactgcacattcagtgaaggaaaagttt
ggaaagaaactctatgatgcattattaagaggagaaattcctgacatgaacaatattttg
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcttta
cctccagtgacaactcacaacatgattgatgactccactgatcccatcctcagcaccata
agacggatcggacttttcaacggccgcacagatagagtcaaggttattttgcacccagag
ttcctatcctccaccagccccttgttacctatggattatgaagagttcgtccgaggttgt
catcttggagtatttccatcatactatgaaccatggggttataccccagctgaatgcact
gtgatgggcatccccagtgtgacaacaaacctctctggctttggctgtttcatgcaggag
cacgtggctgatcctactgcctatggtatttacatcgttgacaggcggttccgttctcct
gatgattcttgcaatcagttgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattatccagagaaaccgcactgagaggctctcagatcttctggactggagatac
ttaggcagatattaccagcacgccaggcacttgacattaagcagagcctttccagataaa
ttctatatggaacctacatcaccgccatcgacagaaggatttaaatatcccaggccctcc
tcagtaccaccttctccttcagggtctcaggtctccagtcctcagagcagtgatgtggaa
gatgaagatgaggatgagagatatgatgaagaagaggaggcagaaagggatcggttgaat
atcaagtcaccatttcctttgggtcatgttcctcatggcaagaaaaagcttcatggtgaa
tacaagaactga

DBGET integrated database retrieval system