KEGG   Pteropus alecto (black flying fox): 102890888
Entry
102890888         CDS       T02993                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03460  Fanconi anemia pathway
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102890888 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102890888 (POLK)
   05202 Transcriptional misregulation in cancer
    102890888 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102890888 (POLK)
   05212 Pancreatic cancer
    102890888 (POLK)
   05225 Hepatocellular carcinoma
    102890888 (POLK)
   05226 Gastric cancer
    102890888 (POLK)
   05214 Glioma
    102890888 (POLK)
   05216 Thyroid cancer
    102890888 (POLK)
   05220 Chronic myeloid leukemia
    102890888 (POLK)
   05217 Basal cell carcinoma
    102890888 (POLK)
   05218 Melanoma
    102890888 (POLK)
   05213 Endometrial cancer
    102890888 (POLK)
   05224 Breast cancer
    102890888 (POLK)
   05222 Small cell lung cancer
    102890888 (POLK)
   05223 Non-small cell lung cancer
    102890888 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102890888 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102890888 (POLK)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102890888 (POLK)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    102890888 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 102890888
NCBI-ProteinID: XP_006913213
UniProt: L5KIG7
LinkDB
Position
Unknown
AA seq 868 aa
MDSTKEKNDNYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQADRFAMELEQNRDLNNTIVHVDMDAFYAAVEMRDN
PELKDKPIAVGSSSMLTTSNYHARRFGVRAAMPGFIAKRLCPQLIIIPPNFDKYRAVSRE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTEESVENDKPGKEDNK
LSEHERSISPLLFEDSPPDLQTPGNTSQVNAEERNNPQILQNSVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLARDAERKSMSVER
TFSEISKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRAYTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRLSSFPNEEDKKHQQRSIIDFLQAGNQTL
SATGCIEKTDKDQFLKPLEMSHKKSFFDKKRSERKWSHQDTLKCETVNRQSLQTSQSFQV
LKRKMNENLETPENSDKGQIFTCPVCFREQGSISLEAFNKHVDACLDGPLISEMFSCSRA
SSTEVNKKENVHYSFSLCEKRDYETHQKNIEITSVDCAELLETVGNSSKAESVDTLSSSH
SKEECSSLPSKSVNIEHYHQNYFCAVSLENEDVESLRMREPLQPYLREATTDQALVCPVC
NLEQKTSDLTLFNVHVDICLNKGIIQELREDRVNPVNQTKESTKSTANSGRVQKTVTKTK
RSGLMTKHSASKKIKPNNPRHTLDIFFK
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagaatgacaattacaaagatgatcttctgcttaggatggga
cttaatgataataaagctgggatggaaggattagataaagagaaaataaacaaaattata
atggaagccacaaaggggtccaaattttatggaaatgagctcaagaaagaaaagcaagtc
aatcaacgaattgaaaatatgatgcaacaaaaagctcaaattactagccagcagctaagg
aaagcacaattacaggctgacagatttgcaatggaactagaacagaaccgggatctgaac
aataccatagtacatgttgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaactaaaggataagcccattgctgtaggatcatcaagtatgttgactacttcaaat
taccatgcaaggaggtttggagttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattataatacccccaaactttgataaatatcgagctgtgagtagagag
gttaaggaaatacttgctgattatgatcctaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcccgaggacaaaagaaag
tatttcatcaaaacagaagagtctgtagaaaatgataaaccaggaaaggaagataataaa
ctgagtgagcatgaacgatccatctctccactgctttttgaagatagtcctcctgatttg
cagaccccaggaaatacttctcaagtgaacgctgaagaacgaaataatcctcaaatactc
caaaactcagttgtttttggtacatcagctgaggaagtggtaaaggaaattcgtttcaga
atcgagcaaaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtgtgcagtgataagaataaaccgaatggacaataccaaattcttcccaacagacaa
gctgtgatggacttcatcaaggacttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacttgtacagagctttaccaacagagg
gcattactttctcttcttttctctgaaacatcttggcattatttccttcatatttccctg
ggtctagggtcaacacacctggcaagggatgcagagaggaaaagcatgagtgttgaaagg
acattcagtgagataagtaaagcagaagaacaatacagcttgtgccaggaactttgcagt
gaacttgctcaggatctgcagaaagaaggacttaagggtagaactgttactattaagctg
aagaatgtgaattttgaagtaaaaactcgtgcatatacagtttcatctgtcgtttctact
gcagaagaaatatttgctattgctaaagaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaagactgatgggtgtgcggctatctagttttcccaatgaagaa
gacaagaaacaccaacaaaggagcattattgatttcttacaggctggaaaccaaacactg
tctgccactgggtgtatagagaaaactgacaaagatcagtttttaaaacctctagaaatg
tctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagccaccaagac
acattgaagtgtgaaactgtgaatagacaaagtttacagacatcacaatcattccaagtt
ttaaagaggaagatgaatgagaatttagaaacaccagagaattcagataagggtcagata
tttacctgccctgtttgctttagggagcaaggaagcatcagtctggaagcctttaataaa
catgtagatgcatgtcttgatggacctttgatcagtgaaatgttctcatgttcacgtgct
tcctctacagaagttaacaagaaagaaaatgtacattattctttttcactctgtgagaag
cgggattatgaaacccatcagaagaacatagaaattacttcagtagattgtgcagagttg
ctagaaactgtaggtaattcatctaaagcagaaagtgtagacactttaagcagtagccac
agcaaagaggaatgttctagtcttccaagcaaatcggttaatatcgaacactatcatcag
aattatttttgtgctgtttcactggaaaatgaagatgttgagtcattgagaatgcgagaa
cctctccagccttatttacgtgaagcaacaacagaccaagctctagtttgtcctgtttgt
aacctagaacaaaagacttcagatcttacccttttcaatgtgcatgtggatatttgccta
aataaaggcattatccaggaactgagagaggatagagttaatccagttaaccaaaccaaa
gaaagcaccaaaagtactgctaactcaggcagagtacagaagactgtaacaaaaacaaaa
agatcaggactgatgacaaagcactcagcatcaaagaaaataaaaccaaacaatccaaga
cacacccttgatatattttttaaatga

DBGET integrated database retrieval system