KEGG   Pteropus alecto (black flying fox): 102890938Help
Entry
102890938         CDS       T02993                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04213  Longevity regulating pathway - multiple species
pale04330  Notch signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05016  Huntington's disease
pale05034  Alcoholism
pale05165  Human papillomavirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pale00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102890938 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102890938 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102890938 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    102890938 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102890938 (HDAC1)
   05202 Transcriptional misregulation in cancers
    102890938 (HDAC1)
   05203 Viral carcinogenesis
    102890938 (HDAC1)
   05220 Chronic myeloid leukemia
    102890938 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    102890938 (HDAC1)
  Substance dependence
   05034 Alcoholism
    102890938 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102890938 (HDAC1)
   05165 Human papillomavirus infection
    102890938 (HDAC1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102890938 (HDAC1)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102890938 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102890938 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102890938 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102890938 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102890938
NCBI-ProteinID: XP_006924353
UniProt: L5JRG0
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKEPEEKKEITEEEKTKEDKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaagcaaatgcagagattcaatgttggtgaggactgt
ccggtatttgatggcctgtttgaattctgtcagttatctactggtggctctgtggcaagt
gctgtgaagcttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttatgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggagctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctacgaggccatt
ttcaagccggtcatatccaaagtaatggagatgttccagcccagtgcagtcgtcttacag
tgtggctctgactccctatctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtgaagagctttaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgttgcccggtgctggacttatgaaacagctgtagccctg
gacacagagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcacatcagcccttctaatatgactaaccaaaacacgaatgagtacttggag
aagatcaaacagcgactatttgagaacctgagaatgctgccccacgcacctggggttcaa
atgcaggcgattcctgaggatgccattccagaggagagtggtgatgaagatgaagaagac
cctgacaaacgcatctcgatctgttcttctgacaaacgaattgcctgtgaggaagagttc
tctgactctgatgaggaaggagaaggtggtcgtaagaactcttccaacttcaaaaaagcg
aagagagtcaaaacagaggatgaaaaagagaaagagccagaagagaagaaagaaatcaca
gaagaagagaaaaccaaggaagacaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system