KEGG   Pteropus alecto (black flying fox): 102891056Help
Entry
102891056         CDS       T02993                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04064  NF-kappa B signaling pathway
pale04210  Apoptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04926  Relaxin signaling pathway
pale04931  Insulin resistance
pale05134  Legionellosis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease (American trypanosomiasis)
pale05145  Toxoplasmosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102891056 (NFKBIA)
   04668 TNF signaling pathway
    102891056 (NFKBIA)
   04024 cAMP signaling pathway
    102891056 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102891056 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102891056 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    102891056 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    102891056 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    102891056 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    102891056 (NFKBIA)
   04660 T cell receptor signaling pathway
    102891056 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    102891056 (NFKBIA)
   04659 Th17 cell differentiation
    102891056 (NFKBIA)
   04657 IL-17 signaling pathway
    102891056 (NFKBIA)
   04662 B cell receptor signaling pathway
    102891056 (NFKBIA)
   04062 Chemokine signaling pathway
    102891056 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102891056 (NFKBIA)
   04926 Relaxin signaling pathway
    102891056 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102891056 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102891056 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891056 (NFKBIA)
   05203 Viral carcinogenesis
    102891056 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102891056 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102891056 (NFKBIA)
   05215 Prostate cancer
    102891056 (NFKBIA)
   05222 Small cell lung cancer
    102891056 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102891056 (NFKBIA)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102891056 (NFKBIA)
   05134 Legionellosis
    102891056 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102891056 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    102891056 (NFKBIA)
   05162 Measles
    102891056 (NFKBIA)
   05164 Influenza A
    102891056 (NFKBIA)
   05161 Hepatitis B
    102891056 (NFKBIA)
   05160 Hepatitis C
    102891056 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    102891056 (NFKBIA)
   05163 Human cytomegalovirus infection
    102891056 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102891056 (NFKBIA)
   05169 Epstein-Barr virus infection
    102891056 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102891056 (NFKBIA)
   05140 Leishmaniasis
    102891056 (NFKBIA)
   05142 Chagas disease (American trypanosomiasis)
    102891056 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102891056 (NFKBIA)
   04131 Membrane trafficking [BR:pale04131]
    102891056 (NFKBIA)
Transcription factors [BR:pale03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102891056 (NFKBIA)
Membrane trafficking [BR:pale04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102891056 (NFKBIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 102891056
NCBI-ProteinID: XP_006913535
UniProt: L5KI12
LinkDB All DBs
Position
Unknown
AA seq 314 aa AA seqDB search
MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSVLQAAN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQLLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcccgccgagcacgcccaggactgggctatggagggcccccgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg
cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcttgcacttg
gccatcatccatgaagagaaggcactgactatggaagtggtccgccaagtgaagggagac
ctggcctttcttaacttccagaacaacctgcagcagactccactccacttggctgtgatt
accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggttgcctggccagtgtg
ggagtcctgactcagagctgtggaacccagcacctccactctgtcctgcaggccgccaac
tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc
cttcatcttgcggtggacctgcagaatcctgacctggtgtcactgttgttgaagtgtggg
gctgacgtcaacagagtcacgtaccagggctactctccataccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagttgctg
ccagagagtgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg
ccttatgatgactgtgtgcttggaggccagcgcctaacgttatga

DBGET integrated database retrieval system