KEGG   Pteropus alecto (black flying fox): 102891202Help
Entry
102891202         CDS       T02993                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102891202 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102891202 (MGST3)
   00982 Drug metabolism - cytochrome P450
    102891202 (MGST3)
   00983 Drug metabolism - other enzymes
    102891202 (MGST3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102891202 (MGST3)
   05204 Chemical carcinogenesis
    102891202 (MGST3)
   05225 Hepatocellular carcinoma
    102891202 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102891202 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    102891202 (MGST3)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102891202 (MGST3)
Transporters [BR:pale02000]
 Other Transporters
  Pores ion channels [TC:1]
   102891202 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102891202
NCBI-ProteinID: XP_006907897
LinkDB All DBs
Position
Un
AA seq 152 aa AA seqDB search
MAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPENGHLFNCIQRA
HQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKRSRGALGSV
ALLGLLGTTVVSAFQHLGWLRPGLGSECKSCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcctctccaaggagtatggcttcgtggtgctgacgggggccgccagcttcatc
atggtcggccatctggccttcaatgtgtccaaggcccgcaagaagtacaaggtggagtac
cccaccatgtacagcgcagaccccgagaacggacacctgttcaactgcattcagcgagcc
caccagaacacgttggaagcgtatccggccttcttgttttttctagctgttgggggtgtt
taccacccgcgagtagcttccggtttgggcctggcctggattgtcggacgggttctctac
gcctacggctattacacaggagaccctagcaagcggagccggggggcgctgggctccgtc
gcccttctcggcttactgggcaccaccgtggtctcggccttccagcacctcggctggctt
agacctggcttgggcagtgagtgcaaatcctgccattaa

DBGET integrated database retrieval system