KEGG   Pteropus alecto (black flying fox): 102891249
Entry
102891249         CDS       T02993                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04012  ErbB signaling pathway
pale04015  Rap1 signaling pathway
pale04062  Chemokine signaling pathway
pale04137  Mitophagy - animal
pale04144  Endocytosis
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04520  Adherens junction
pale04530  Tight junction
pale04540  Gap junction
pale04611  Platelet activation
pale04613  Neutrophil extracellular trap formation
pale04625  C-type lectin receptor signaling pathway
pale04727  GABAergic synapse
pale04750  Inflammatory mediator regulation of TRP channels
pale04810  Regulation of actin cytoskeleton
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale05100  Bacterial invasion of epithelial cells
pale05135  Yersinia infection
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05219  Bladder cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102891249 (SRC)
   04015 Rap1 signaling pathway
    102891249 (SRC)
   04370 VEGF signaling pathway
    102891249 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102891249 (SRC)
   04137 Mitophagy - animal
    102891249 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102891249 (SRC)
   04520 Adherens junction
    102891249 (SRC)
   04530 Tight junction
    102891249 (SRC)
   04540 Gap junction
    102891249 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102891249 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102891249 (SRC)
   04613 Neutrophil extracellular trap formation
    102891249 (SRC)
   04625 C-type lectin receptor signaling pathway
    102891249 (SRC)
   04062 Chemokine signaling pathway
    102891249 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102891249 (SRC)
   04915 Estrogen signaling pathway
    102891249 (SRC)
   04917 Prolactin signaling pathway
    102891249 (SRC)
   04921 Oxytocin signaling pathway
    102891249 (SRC)
   04926 Relaxin signaling pathway
    102891249 (SRC)
   04919 Thyroid hormone signaling pathway
    102891249 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    102891249 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102891249 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    102891249 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102891249 (SRC)
   05203 Viral carcinogenesis
    102891249 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    102891249 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891249 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102891249 (SRC)
   05152 Tuberculosis
    102891249 (SRC)
   05100 Bacterial invasion of epithelial cells
    102891249 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102891249 (SRC)
   05168 Herpes simplex virus 1 infection
    102891249 (SRC)
   05163 Human cytomegalovirus infection
    102891249 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102891249 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102891249 (SRC)
   01522 Endocrine resistance
    102891249 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102891249 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102891249 (SRC)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102891249 (SRC)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  SRC family
   102891249 (SRC)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102891249 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102891249 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102891249 (SRC)
  Macropinocytosis
   Kinases
    102891249 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 102891249
NCBI-ProteinID: XP_006921860
UniProt: L5K0Y6
LinkDB
Position
Unknown
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENAHGGGGGAFPTSQTPSKPASADGHRGPNTAFSPAASE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcttggagcct
gccgagaacgcccacggtggtggcgggggcgccttccccacctcacagacccccagcaag
ccggcttccgctgatggccaccgcggccccaacacggccttcagccccgcggcctccgag
cccaagctcttcgggggcttcaactcctcggataccgtcacctccccgcagagggcgggg
ccgctggctgggggagtgaccacctttgtggccctctatgactatgagtcacggacagag
accgacctatccttcaagaaaggggagcggctccagattgtcaacaacacagagggagac
tggtggcttgcccactcgctcagcaccggacagacgggctacatccccagcaactacgtg
gcgccctctgattccatccaagccgaggagtggtactttggcaagatcaccagacgggag
tcagagcggttactgctcaacgcggagaacccgagagggaccttcctagtgcgagaaagc
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaatgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagtggcggcttctacatcacctctcgc
acccagttcaacagtctgcagcagctcgtagcctactactccaaacatgctgatggcctg
tgccaccgcctcaccactgtgtgccccacatccaagccacagactcagggcctggccaag
gatgcctgggagatcccccgggagtcactgcggctggaggtcaagctgggccagggctgc
tttggagaggtgtggatggggacctggaatggcaccaccagggtggccatcaaaaccctg
aagccgggcacgatgtctccagaggccttcctgcaggaggcccaggtgatgaagaaactc
aggcacgagaagctggtgcagctgtatgcggtggtgtctgaggagcccatctacatcgtc
acggaatacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagattgcctcaggcatggcatatgtg
gagcggatgaactacgtccaccgggacctccgagctgccaacatcctggttggagagaac
cttgtgtgcaaagtagctgacttcgggctggctcggctcatcgaagacaatgagtacaca
gcccggcaaggtgccaaattccccatcaagtggacagctccagaagctgccctctatggc
cggttcaccatcaagtcggacgtgtggtcctttgggatcctgctgacagagcttacaaca
aagggacgggtgccctaccctgggatggtaaaccgagaggtgctggatcaggtggagcgg
ggctaccggatgccctgcccgcctgagtgtcctgagtccctgcacgacctcatgtgccag
tgctggcggaaggagccagaggaacggcccacctttgagtacctacaggcctttctggag
gactatttcacatccaccgagccccagtatcagcctggagagaacctatag

DBGET integrated database retrieval system