KEGG   Pteropus alecto (black flying fox): 102891428
Entry
102891428         CDS       T02993                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04024  cAMP signaling pathway
pale04210  Apoptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04668  TNF signaling pathway
pale04713  Circadian entrainment
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04932  Non-alcoholic fatty liver disease
pale04935  Growth hormone synthesis, secretion and action
pale05031  Amphetamine addiction
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05224  Breast cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05323  Rheumatoid arthritis
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102891428 (FOS)
   04668 TNF signaling pathway
    102891428 (FOS)
   04024 cAMP signaling pathway
    102891428 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102891428 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102891428 (FOS)
   04660 T cell receptor signaling pathway
    102891428 (FOS)
   04658 Th1 and Th2 cell differentiation
    102891428 (FOS)
   04659 Th17 cell differentiation
    102891428 (FOS)
   04657 IL-17 signaling pathway
    102891428 (FOS)
   04662 B cell receptor signaling pathway
    102891428 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102891428 (FOS)
   04917 Prolactin signaling pathway
    102891428 (FOS)
   04921 Oxytocin signaling pathway
    102891428 (FOS)
   04926 Relaxin signaling pathway
    102891428 (FOS)
   04935 Growth hormone synthesis, secretion and action
    102891428 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    102891428 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    102891428 (FOS)
   04728 Dopaminergic synapse
    102891428 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102891428 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102891428 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891428 (FOS)
   05231 Choline metabolism in cancer
    102891428 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102891428 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102891428 (FOS)
   05224 Breast cancer
    102891428 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102891428 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    102891428 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891428 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102891428 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102891428 (FOS)
   05135 Yersinia infection
    102891428 (FOS)
   05133 Pertussis
    102891428 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102891428 (FOS)
   05170 Human immunodeficiency virus 1 infection
    102891428 (FOS)
   05161 Hepatitis B
    102891428 (FOS)
   05171 Coronavirus disease - COVID-19
    102891428 (FOS)
   05162 Measles
    102891428 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102891428 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102891428 (FOS)
   05142 Chagas disease
    102891428 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102891428 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102891428 (FOS)
   04131 Membrane trafficking [BR:pale04131]
    102891428 (FOS)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102891428 (FOS)
Membrane trafficking [BR:pale04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102891428 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ UPF0242
Other DBs
NCBI-GeneID: 102891428
NCBI-ProteinID: XP_006925520
UniProt: L5JSB2
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLASSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPAKNISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccagccggggacagtctctcctactaccactcaccggctgactctttctccagcatg
ggctctcctgtcaacggacaggacttctgcactgatctggcctcctccagtgccaacttc
atcccaactgtgactgccatctcaaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggagttcccacc
ccctcagctggggcttactccagagctggagtcatgaagactgtgacaggaagcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaggaagagaaaagg
agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggagaagggag
ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttgcag
actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc
cttgatctgagtgggggcctgcctgaggctgccacccctgagtctgaggaggccttcacc
ctgcccctcctcaatgaccctgagcctaagccctcagtggagcctgccaagaacatcagc
agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagaccgcccgctctgtgccagacatggatctgtctggttccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc
tttgtcttcacctatcccgaagctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcactgagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system